(data stored in SCRATCH9089 zone)

EMBL: CP000124.FMT

CP000124.FMT         Location/Qualifiers
FT   CDS             363680..364663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BURPS1710b_0347"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47683"
FT                   /db_xref="GOA:Q3JXE1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXE1"
FT                   /protein_id="ABA47683.1"
FT                   /translation="MTHSLRVIFAGTPEFAAAALAAIHEAGFPVPLVLTQPDRPAGRGM
FT                   KLQASAVKRYAFERGMAVAQPPSLRRAGKYPAEAVAALDLLHATPHDVMVVAAYGLLLP
FT                   QEVLELPRHGCINIHASLLPRWRGAAPIHRAIEAGDAETGVTLMQMDAGLDTGAMLHEA
FT                   RVAIAPDDTTATLHDKLAAAGARLVVDALVELERTGALAATPQPADGVTYAEKIGKHEA
FT                   ALDWRKPAAALARQVRAFDPFPGGAGTLDGATLKLWAADAVPGRDDAAPGTIVDIGPDG
FT                   VVIACGEGALRVTQLQKPGGKRLPAREFLAGAPLAVGQRFAPADAA"
     MTHSLRVIFA GTPEFAAAAL AAIHEAGFPV PLVLTQPDRP AGRGMKLQAS AVKRYAFERG        60
     MAVAQPPSLR RAGKYPAEAV AALDLLHATP HDVMVVAAYG LLLPQEVLEL PRHGCINIHA       120
     SLLPRWRGAA PIHRAIEAGD AETGVTLMQM DAGLDTGAML HEARVAIAPD DTTATLHDKL       180
     AAAGARLVVD ALVELERTGA LAATPQPADG VTYAEKIGKH EAALDWRKPA AALARQVRAF       240
     DPFPGGAGTL DGATLKLWAA DAVPGRDDAA PGTIVDIGPD GVVIACGEGA LRVTQLQKPG       300
     GKRLPAREFL AGAPLAVGQR FAPADAA                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page