(data stored in SCRATCH9089 zone)

EMBL: CP000124.FOLB

CP000124.FOLB        Location/Qualifiers
FT   CDS             complement(527811..528242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BURPS1710b_0520"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48612"
FT                   /db_xref="GOA:Q3JWW9"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW9"
FT                   /protein_id="ABA48612.1"
FT                   /translation="MPHPLTGTTMFAALLHPRLADCRRLYLRNHEVYMNIGAFEHEKRG
FT                   EQRVVINVDLFVPLALTTPVEDRLREVVDYDLMKQSVAQCVARGHIHLQETLCDAIAAS
FT                   LLAHDAVRAVRVSTEKPDAYPDCDAVGVEVFRIKDEERA"
     MPHPLTGTTM FAALLHPRLA DCRRLYLRNH EVYMNIGAFE HEKRGEQRVV INVDLFVPLA        60
     LTTPVEDRLR EVVDYDLMKQ SVAQCVARGH IHLQETLCDA IAASLLAHDA VRAVRVSTEK       120
     PDAYPDCDAV GVEVFRIKDE ERA                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page