(data stored in SCRATCH9089 zone)

EMBL: CP000124.GATA

CP000124.GATA        Location/Qualifiers
FT   CDS             383895..385385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BURPS1710b_0368"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48820"
FT                   /db_xref="GOA:Q3JXC1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXC1"
FT                   /protein_id="ABA48820.1"
FT                   /translation="MHAKSLTELRAALDAKECSAVELAQHYLKRIDAARDLNAFVHVDA
FT                   ELTLAQAKAADAALANGEAGPLAGLPIAHKDVFVTRGWRSTAGSKMLANYASPFDATVV
FT                   ARLSAAGMVTLGKTNMDEFAMGSSNENSAFGPVKNPWDTSAVPGGSSGGSSAAVAARLA
FT                   PAATGTDTGGSIRQPASFAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMARSAADCALL
FT                   LNAMAGFDERDSTSLERADEDYTRHLGKAWAAGGDAGKPLAGLRIGLPAEYFGAGLADD
FT                   VRAAIDAALKTYEALGATLVPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAA
FT                   EYRDLLDMYKKSRAEGFGPEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAF
FT                   KSCDVIMGPASPTVAWDIGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAK
FT                   RPVGLQIIGNYFDEARMLQVADAFQRATDWHVQEPAGV"
     MHAKSLTELR AALDAKECSA VELAQHYLKR IDAARDLNAF VHVDAELTLA QAKAADAALA        60
     NGEAGPLAGL PIAHKDVFVT RGWRSTAGSK MLANYASPFD ATVVARLSAA GMVTLGKTNM       120
     DEFAMGSSNE NSAFGPVKNP WDTSAVPGGS SGGSSAAVAA RLAPAATGTD TGGSIRQPAS       180
     FAGVTGIKPT YGRVSRYGMI AFASSLDQGG PMARSAADCA LLLNAMAGFD ERDSTSLERA       240
     DEDYTRHLGK AWAAGGDAGK PLAGLRIGLP AEYFGAGLAD DVRAAIDAAL KTYEALGATL       300
     VPVSLPKTEL SIPVYYVIAP AEASSNLSRF DGVRYGHRAA EYRDLLDMYK KSRAEGFGPE       360
     VKRRILVGTY VLSHGYYDAY YLQAQKIRRI IAQDFQEAFK SCDVIMGPAS PTVAWDIGAK       420
     GDDPVQMYLA DIYTLSVSLA GLPGMSVPCG FGAGANAKRP VGLQIIGNYF DEARMLQVAD       480
     AFQRATDWHV QEPAGV                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page