(data stored in SCRATCH9089 zone)

EMBL: CP000124.GCVP

CP000124.GCVP        Location/Qualifiers
FT   CDS             134948..137875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="BURPS1710b_0129"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="identified by match to protein family HMM PF01212;
FT                   match to protein family HMM PF02347; match to protein
FT                   family HMM TIGR00461"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48266"
FT                   /db_xref="GOA:Q3JY08"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY08"
FT                   /protein_id="ABA48266.1"
FT                   /translation="MKLEHPDRLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDTL
FT                   GFATRAALIDAVIPASIRRAETLPLGPFAQPKSEAEALAALRALADKNQVFRSYIGQGY
FT                   YDTHTPAVILRNVLENPAWYTAYTPYQPEISQGRLEALLNFQQMVADLTGLEISNASLL
FT                   DEATAAAEAMTLLQRVGKPQSNVFYVADDVLPQTLEVIKTRAKPIGIEVKSGPAADAAA
FT                   ANAFGVLLQYPGANGDVRDYRALADAIHAAGGHVVVAADILALTVLMPPGEWGADVAVG
FT                   NTQRFGVPMGFGGPHAAYMAVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTREQHIRR
FT                   EKATSNVCTAQALLAIMASMYAVYHGPRGLKTIALRVNRIAALLAAGIRHLGYATVNDT
FT                   FFDTLTIDTGARTAQLHAFAQAKRINLRRAGDTRVGVSVDETTTRADLADLLTIFAQAA
FT                   GATAPDIDALDAGLLPAPALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLAL
FT                   DRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATG
FT                   YAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVV
FT                   VVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVY
FT                   VDGANMNAMVGLTAPGQFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVGPHLAKFLPNQR
FT                   STGYARGEDGIGAVSAAPYGSASILPISWMYIAMMGAKNLTAATETAILNANYIAKRLA
FT                   PHYPVLYSGPGGLVAHECILDLRPIKDSSGITVDDVAKRLMDYGFHAPTMSFPVPGTLM
FT                   VEPTESESQEELDRFIAAMIAIRDEIRAVEEGRADREDNPLRHAPHTAAVVTANEWPHA
FT                   YSREQAAFPVASLVANKYWPPVGRADNAYGDRNLFCSCVPVSDYA"
     MKLEHPDRLM NRTPLSLAAL ETHDAFAERH IGPDAASQQA MLDTLGFATR AALIDAVIPA        60
     SIRRAETLPL GPFAQPKSEA EALAALRALA DKNQVFRSYI GQGYYDTHTP AVILRNVLEN       120
     PAWYTAYTPY QPEISQGRLE ALLNFQQMVA DLTGLEISNA SLLDEATAAA EAMTLLQRVG       180
     KPQSNVFYVA DDVLPQTLEV IKTRAKPIGI EVKSGPAADA AAANAFGVLL QYPGANGDVR       240
     DYRALADAIH AAGGHVVVAA DILALTVLMP PGEWGADVAV GNTQRFGVPM GFGGPHAAYM       300
     AVRDEFKRQM PGRLVGVTVD AQGKPALRLA LQTREQHIRR EKATSNVCTA QALLAIMASM       360
     YAVYHGPRGL KTIALRVNRI AALLAAGIRH LGYATVNDTF FDTLTIDTGA RTAQLHAFAQ       420
     AKRINLRRAG DTRVGVSVDE TTTRADLADL LTIFAQAAGA TAPDIDALDA GLLPAPALPP       480
     SLERTSAYLT HHVFNRHHSE TEMLRYLRSL SDKDLALDRS MIPLGSCTMK LNATSEMLPV       540
     TWPEFGRIHP FAPAEQTVGY REMIDQLEQM LVAATGYAAV SLQPNAGSQG EYAGLLIIHA       600
     YHESRGESHR DVCLIPASAH GTNPASAHMA GMKVVVVACD AQGNVDIADL KAKADAHSHD       660
     LAAIMITYPS THGVFEQNVR EICEIVHAHG GQVYVDGANM NAMVGLTAPG QFGGDVSHLN       720
     LHKTFCIPHG GGGPGVGPVA VGPHLAKFLP NQRSTGYARG EDGIGAVSAA PYGSASILPI       780
     SWMYIAMMGA KNLTAATETA ILNANYIAKR LAPHYPVLYS GPGGLVAHEC ILDLRPIKDS       840
     SGITVDDVAK RLMDYGFHAP TMSFPVPGTL MVEPTESESQ EELDRFIAAM IAIRDEIRAV       900
     EEGRADREDN PLRHAPHTAA VVTANEWPHA YSREQAAFPV ASLVANKYWP PVGRADNAYG       960
     DRNLFCSCVP VSDYA                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page