(data stored in SCRATCH9089 zone)

EMBL: CP000124.GLMU

CP000124.GLMU        Location/Qualifiers
FT   CDS             complement(524880..526565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BURPS1710b_0518"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF00483; match to protein
FT                   family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49097"
FT                   /db_xref="GOA:Q3JWX1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWX1"
FT                   /protein_id="ABA49097.1"
FT                   /translation="MARIARRPAPPGHACSPARRTLSRPARHIRLASSPAPPDLARLPD
FT                   RFGATRRRPRGRLALPAFVRLERTSRPRPPAAAAPGPPGCPAAPDGARMLEWPASNSPY
FT                   ETGAMNIVILAAGTGKRMRSALPKVLHPLAGRPLLSHVIDTARALAPSRLVVVIGHGAE
FT                   QVRAAVAAPDVQFAVQEQQLGTGHAVRQALPLLDPSQPTLVLYGDVPLTRTATLKRLAD
FT                   AATDARYGVLTVTLDDPTGYGRIVRDQAGCVTRIVEQKDASPDELRIDEINTGIVVAPT
FT                   AQLSMWLGALGNDNAQGEYYLTDVVEQAIEAGFEIVTTQPDDEWETLGVNSKAQLAELE
FT                   RIHQRNLADALLAAGVTLADPARIDVRGTLACGRDVSIDVNCVFEGDVTLADGVTIGAN
FT                   CVIRHAAIAAGARVDAFSHLDGATVGANAVVGPYARLRPGAVLAADAHVGNFVEVKNAT
FT                   LGQGSKANHLTYLGDADIGARVNVGAGTITCNYDGANKFRTVIEDDVFVGSDTQFVAPV
FT                   RVGRGVTVAAGTTVWKDVAADMLVLNDKTQTAKSGYVRPVKKKS"
     MARIARRPAP PGHACSPARR TLSRPARHIR LASSPAPPDL ARLPDRFGAT RRRPRGRLAL        60
     PAFVRLERTS RPRPPAAAAP GPPGCPAAPD GARMLEWPAS NSPYETGAMN IVILAAGTGK       120
     RMRSALPKVL HPLAGRPLLS HVIDTARALA PSRLVVVIGH GAEQVRAAVA APDVQFAVQE       180
     QQLGTGHAVR QALPLLDPSQ PTLVLYGDVP LTRTATLKRL ADAATDARYG VLTVTLDDPT       240
     GYGRIVRDQA GCVTRIVEQK DASPDELRID EINTGIVVAP TAQLSMWLGA LGNDNAQGEY       300
     YLTDVVEQAI EAGFEIVTTQ PDDEWETLGV NSKAQLAELE RIHQRNLADA LLAAGVTLAD       360
     PARIDVRGTL ACGRDVSIDV NCVFEGDVTL ADGVTIGANC VIRHAAIAAG ARVDAFSHLD       420
     GATVGANAVV GPYARLRPGA VLAADAHVGN FVEVKNATLG QGSKANHLTY LGDADIGARV       480
     NVGAGTITCN YDGANKFRTV IEDDVFVGSD TQFVAPVRVG RGVTVAAGTT VWKDVAADML       540
     VLNDKTQTAK SGYVRPVKKK S                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page