(data stored in SCRATCH9089 zone)

EMBL: CP000124.GLOB1

CP000124.GLOB1       Location/Qualifiers
FT   CDS             47294..47938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glob1"
FT                   /locus_tag="BURPS1710b_0044"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /EC_number="3.-.-.-"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49926"
FT                   /db_xref="GOA:Q3JY92"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY92"
FT                   /protein_id="ABA49926.1"
FT                   /translation="MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQ
FT                   HVQVEKVLLTHGHVDHCAGAKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPAAEA
FT                   FEPDRWLADGDTLAFGEETLEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDF
FT                   PRGNHADLIRSIREKLWPLGDDVTFVPGHGPVSTFGDERRTNPFVADEVAG"
     MKVTLIPVTP FQQNCSLLVC EKTGRAAVVD PGGDLELIEQ EVARQHVQVE KVLLTHGHVD        60
     HCAGAKRLAA HYGVPIEGPH EDERFWIEKL PMQSERFGFP AAEAFEPDRW LADGDTLAFG       120
     EETLEVYHCP GHTPGHVVFF SRAHRLAIVG DVLFAGSIGR TDFPRGNHAD LIRSIREKLW       180
     PLGDDVTFVP GHGPVSTFGD ERRTNPFVAD EVAG                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page