(data stored in SCRATCH9089 zone)

EMBL: CP000124.GSHA

CP000124.GSHA        Location/Qualifiers
FT   CDS             337965..339611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="BURPS1710b_0324"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04262;
FT                   match to protein family HMM TIGR01434"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50159"
FT                   /db_xref="GOA:Q3JXG3"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG3"
FT                   /protein_id="ABA50159.1"
FT                   /translation="MPRIAEPALASMPNNMTSRQTDLLQQRLAVLSTSPTREQLPDGLR
FT                   GIEKESLRVTRDGMIAFTPHPRALGSALTHPSLTTDYSEALVELITPAERDAATTLKRL
FT                   DELHRYVYASLGDEMLWTDSMPGLLPADDEIPIADYGTSNIGRLKTVYRRGLAYRYGRT
FT                   MQCIAGIHYNYSLSEEVWRRLHAEEGSTAGIVDYQSERYLALIRNFRRTSWLLMYLFGA
FT                   SPALDAGFLRGRAHKLDTFDAATLYRPHATSLRMSDLGYSNTTAQAALQADYNTLSGYL
FT                   DALSKAVSEPYPPYEAIGTHRDGEWIQINTNVLQIENEFYSTIRPKRVTYSGERPLHAL
FT                   ASRGVQYIEVRCLDIDPFEPTGIALDTARFLDAYLLVCALDESAPLTCDAYRESNANFG
FT                   RVTMEGRKPGLELTRDGAAVPMRAWADEIFAQIEAAGRVLDDIRGDDTHARAIAAQRAK
FT                   LDDPELTSSARVLRAMRENGQSFLEFARAQSAAHAAYFHGRPLDEAATRDARALAERSL
FT                   AEQAELEGKNAGSFDAFVAAYRAYTLNRFSV"
     MPRIAEPALA SMPNNMTSRQ TDLLQQRLAV LSTSPTREQL PDGLRGIEKE SLRVTRDGMI        60
     AFTPHPRALG SALTHPSLTT DYSEALVELI TPAERDAATT LKRLDELHRY VYASLGDEML       120
     WTDSMPGLLP ADDEIPIADY GTSNIGRLKT VYRRGLAYRY GRTMQCIAGI HYNYSLSEEV       180
     WRRLHAEEGS TAGIVDYQSE RYLALIRNFR RTSWLLMYLF GASPALDAGF LRGRAHKLDT       240
     FDAATLYRPH ATSLRMSDLG YSNTTAQAAL QADYNTLSGY LDALSKAVSE PYPPYEAIGT       300
     HRDGEWIQIN TNVLQIENEF YSTIRPKRVT YSGERPLHAL ASRGVQYIEV RCLDIDPFEP       360
     TGIALDTARF LDAYLLVCAL DESAPLTCDA YRESNANFGR VTMEGRKPGL ELTRDGAAVP       420
     MRAWADEIFA QIEAAGRVLD DIRGDDTHAR AIAAQRAKLD DPELTSSARV LRAMRENGQS       480
     FLEFARAQSA AHAAYFHGRP LDEAATRDAR ALAERSLAEQ AELEGKNAGS FDAFVAAYRA       540
     YTLNRFSV                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page