(data stored in SCRATCH9089 zone)

EMBL: CP000124.GSPE

CP000124.GSPE        Location/Qualifiers
FT   CDS             233445..234938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="BURPS1710b_0221"
FT                   /product="general secretory pathway protein E"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR02533"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47994"
FT                   /db_xref="GOA:Q3JXR6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR6"
FT                   /protein_id="ABA47994.1"
FT                   /translation="MTQALAQGAPDQPAAGAPSPIAARLLPYGFAKAGQILIAHQHADT
FT                   LEVWISERTSSAALAEVARNFGAISLQRMPADELAQAINHAYARQDGSAAQIVGEVEGE
FT                   VDLSRLMQDIPEVEDLLESEDDAPIIRMINALLTQAAREQASDIHIEPFENASVVRFRV
FT                   DGTLRDVVRPKKALHGALISRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTLPT
FT                   GHGERAVLRLLEKDAQRLNLEALGMGRDTLVQFDKLISRPHGIVLVTGPTGSGKTTTLY
FT                   ASMSRLETATTNIMTVEDPIEYDLSGIGQTQVNERIGMTFARALRSILRQDPDIIMIGE
FT                   IRDLETAQIAVQASLTGHLVLATLHTNDAASAVTRLTDMGVEPYLLASSLLGVLAQRLV
FT                   RQLCPACKEERHEGGRAVWHPVGCDKCGHSGYTGRRGVYELLVIDDSIRSLIHRNAADA
FT                   EILATGRANGMRTLRDDAERWLAAGATSLEEVLRVTGGA"
     MTQALAQGAP DQPAAGAPSP IAARLLPYGF AKAGQILIAH QHADTLEVWI SERTSSAALA        60
     EVARNFGAIS LQRMPADELA QAINHAYARQ DGSAAQIVGE VEGEVDLSRL MQDIPEVEDL       120
     LESEDDAPII RMINALLTQA AREQASDIHI EPFENASVVR FRVDGTLRDV VRPKKALHGA       180
     LISRIKIMAQ LDIAEKRLPQ DGRITLRVGG RPVDVRVSTL PTGHGERAVL RLLEKDAQRL       240
     NLEALGMGRD TLVQFDKLIS RPHGIVLVTG PTGSGKTTTL YASMSRLETA TTNIMTVEDP       300
     IEYDLSGIGQ TQVNERIGMT FARALRSILR QDPDIIMIGE IRDLETAQIA VQASLTGHLV       360
     LATLHTNDAA SAVTRLTDMG VEPYLLASSL LGVLAQRLVR QLCPACKEER HEGGRAVWHP       420
     VGCDKCGHSG YTGRRGVYEL LVIDDSIRSL IHRNAADAEI LATGRANGMR TLRDDAERWL       480
     AAGATSLEEV LRVTGGA                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page