(data stored in SCRATCH9089 zone)

EMBL: CP000124.GSPI

CP000124.GSPI        Location/Qualifiers
FT   CDS             237879..238283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="BURPS1710b_0226"
FT                   /product="general secretory pathway protein I"
FT                   /note="identified by match to protein family HMM PF02501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47586"
FT                   /db_xref="GOA:Q3JXR1"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR1"
FT                   /protein_id="ABA47586.1"
FT                   /translation="MRAPAPPRSPARSRGFTMIEVLVALAIIAVALAASIRAVGSMATG
FT                   ASDLHARLLAGWSADNALAQLRLAHAWPDIGMQTFDCSQGNVALTCTQRVSSTPNPVFR
FT                   RVEIAVSMNGRAGVLAQMVTVVANETSRPL"
     MRAPAPPRSP ARSRGFTMIE VLVALAIIAV ALAASIRAVG SMATGASDLH ARLLAGWSAD        60
     NALAQLRLAH AWPDIGMQTF DCSQGNVALT CTQRVSSTPN PVFRRVEIAV SMNGRAGVLA       120
     QMVTVVANET SRPL                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page