(data stored in SCRATCH9089 zone)

EMBL: CP000124.GSPM

CP000124.GSPM        Location/Qualifiers
FT   CDS             241693..242199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspM"
FT                   /locus_tag="BURPS1710b_0230"
FT                   /product="general secretory pathway protein M"
FT                   /note="identified by match to protein family HMM PF04612"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48585"
FT                   /db_xref="GOA:Q3JXQ7"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ7"
FT                   /protein_id="ABA48585.1"
FT                   /translation="MKTTEFNEALSQFWEARTAREKLLLGWGGAVLALAIAYSVLWSPA
FT                   QEGRARIQRELPTMRHELAEMTAQANEARSLAGAAQGVAPTGVALKDALAASLSDHGLA
FT                   AAAPQVVGGGVQIQLKNASFPAWTQWLDDVRRQFKAQVVEAHVSALKEDGQVDLTAVLQ
FT                   PASVK"
     MKTTEFNEAL SQFWEARTAR EKLLLGWGGA VLALAIAYSV LWSPAQEGRA RIQRELPTMR        60
     HELAEMTAQA NEARSLAGAA QGVAPTGVAL KDALAASLSD HGLAAAAPQV VGGGVQIQLK       120
     NASFPAWTQW LDDVRRQFKA QVVEAHVSAL KEDGQVDLTA VLQPASVK                    168
//

If you have problems or comments...

PBIL Back to PBIL home page