(data stored in SCRATCH9089 zone)

EMBL: CP000124.HDAH1

CP000124.HDAH1       Location/Qualifiers
FT   CDS             345424..346476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdah1"
FT                   /locus_tag="BURPS1710b_0332"
FT                   /product="histone deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48929"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF5"
FT                   /protein_id="ABA48929.1"
FT                   /translation="MYVVPHGTLNLGEHFDSPLRLAYTKQLLDAVGMTERLTRVAFARA
FT                   TDEQLLRVHRPEYLRQLAEACAVAGEQVVRLGDDAAGSASTEDVARLAAGAACAAVDAV
FT                   MTGPLRQAYALIRPSGHHAGADFAMGYCYYNNVAIAARHAQAAHGVERVAIVDWDVHHG
FT                   NGTQQAFYDDPSVLFVSLHEAANFPVDGGEARETGGGAGAGYNANVPLPSGTGDAGYRH
FT                   AFDELVLPLVEAFAPQLILVSAGQDANAFDPLGRMRVQRDGFRHMARALRQAAGGACGG
FT                   RIVMLQEGGYSLPYLPIATLGVLEGLVGWNAPFDDPHQFVQYPLGEGERAAVKAARAAL
FT                   APYWPTLHRS"
     MYVVPHGTLN LGEHFDSPLR LAYTKQLLDA VGMTERLTRV AFARATDEQL LRVHRPEYLR        60
     QLAEACAVAG EQVVRLGDDA AGSASTEDVA RLAAGAACAA VDAVMTGPLR QAYALIRPSG       120
     HHAGADFAMG YCYYNNVAIA ARHAQAAHGV ERVAIVDWDV HHGNGTQQAF YDDPSVLFVS       180
     LHEAANFPVD GGEARETGGG AGAGYNANVP LPSGTGDAGY RHAFDELVLP LVEAFAPQLI       240
     LVSAGQDANA FDPLGRMRVQ RDGFRHMARA LRQAAGGACG GRIVMLQEGG YSLPYLPIAT       300
     LGVLEGLVGW NAPFDDPHQF VQYPLGEGER AAVKAARAAL APYWPTLHRS                  350
//

If you have problems or comments...

PBIL Back to PBIL home page