(data stored in SCRATCH9089 zone)

EMBL: CP000124.HPIS

CP000124.HPIS        Location/Qualifiers
FT   CDS             447510..447824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpiS"
FT                   /locus_tag="BURPS1710b_0435"
FT                   /product="high potential iron-sulfur protein precursor"
FT                   /note="HiPIP; identified by match to protein family HMM
FT                   PF01355"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48294"
FT                   /db_xref="GOA:Q3JX54"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX54"
FT                   /protein_id="ABA48294.1"
FT                   /translation="MKTSRRSFLITSVGAVSALALTREAFSADLPMLSETDPTAVALGY
FT                   KADATKVDKAKFPKYAAGEACAGCMLYQGKKGSASGPCGAFPGKQVAAKGWCNAFTKMA
FT                   "
     MKTSRRSFLI TSVGAVSALA LTREAFSADL PMLSETDPTA VALGYKADAT KVDKAKFPKY        60
     AAGEACAGCM LYQGKKGSAS GPCGAFPGKQ VAAKGWCNAF TKMA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page