(data stored in SCRATCH9089 zone)

EMBL: CP000124.HSLU

CP000124.HSLU        Location/Qualifiers
FT   CDS             complement(401209..402552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="BURPS1710b_0385"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM TIGR00390"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51182"
FT                   /db_xref="GOA:Q3JXA4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXA4"
FT                   /protein_id="ABA51182.1"
FT                   /translation="MSTMTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLI
FT                   EISVKQTRETEMRKVRSKATDLAEDRILDVLLPQPRAVGFGASAEHANDDNNATRQTFR
FT                   KRLREGQLDDKEIELDIEQPAVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIK
FT                   EALKLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNHEGGGGEVSRQGV
FT                   QRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLS
FT                   VKDFEAILVATDASLVKQYQALLATEDVKLEFADDGIRRLAEIAYAVNEKTENIGARRL
FT                   YTVIEKLLEEVSFAAGNHAGQSVTIDSAYVDHALGEVSKDEDLSRYVL"
     MSTMTPAEIV SELDKHIIGQ AKAKKAVAVA LRNRWRRQQV AEPLRQEITP KNILMIGPTG        60
     VGKTEIARRL AKLADAPFIK IEATKFTEVG YVGRDVDSIV RDLIEISVKQ TRETEMRKVR       120
     SKATDLAEDR ILDVLLPQPR AVGFGASAEH ANDDNNATRQ TFRKRLREGQ LDDKEIELDI       180
     EQPAVGMDIM APPGMEEMTE QIRSMFSNLG SGKKQRRKVK IKEALKLLTD EEAAKMLNDE       240
     EVKTKAVQNV EQNGIVFLDE IDKITSRNHE GGGGEVSRQG VQRDLLPLVE GTTINTKYGM       300
     VKTDHILFIA SGAFHLAKPS DLIPELQGRF PIRVELDSLS VKDFEAILVA TDASLVKQYQ       360
     ALLATEDVKL EFADDGIRRL AEIAYAVNEK TENIGARRLY TVIEKLLEEV SFAAGNHAGQ       420
     SVTIDSAYVD HALGEVSKDE DLSRYVL                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page