(data stored in SCRATCH9089 zone)

EMBL: CP000124.HTPX

CP000124.HTPX        Location/Qualifiers
FT   CDS             365529..366386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="BURPS1710b_0349"
FT                   /product="HtpX-2 endopeptidase"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47921"
FT                   /db_xref="GOA:Q3JXD9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXD9"
FT                   /protein_id="ABA47921.1"
FT                   /translation="MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLIALGMNFFS
FT                   YWFSDKMVLRMYNAQEVDEATAPQFYRMVRELATRANLPMPRVYLIDENQPNAFATGRN
FT                   PEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTISATMAGAISALANFAMF
FT                   FGGRDENGRPANPIAGIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASA
FT                   LDKIHRYASGIPFQTAEEHPATAQMMIMNPLSGGGLQNLFSTHPATEERIARLMDMART
FT                   GRFD"
     MFNWVKTAML MAAITALFIV IGGMIGGSRG MTIALLIALG MNFFSYWFSD KMVLRMYNAQ        60
     EVDEATAPQF YRMVRELATR ANLPMPRVYL IDENQPNAFA TGRNPEHAAV AATTGILRVL       120
     SEREMRGVMA HELAHVKHRD ILISTISATM AGAISALANF AMFFGGRDEN GRPANPIAGI       180
     AVALLAPIAG ALIQMAISRA REFEADRGGA QISGDPQALA SALDKIHRYA SGIPFQTAEE       240
     HPATAQMMIM NPLSGGGLQN LFSTHPATEE RIARLMDMAR TGRFD                       285
//

If you have problems or comments...

PBIL Back to PBIL home page