(data stored in SCRATCH9089 zone)

EMBL: CP000124.HTRB

CP000124.HTRB        Location/Qualifiers
FT   CDS             complement(409580..410464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="BURPS1710b_0394"
FT                   /product="Lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50012"
FT                   /db_xref="GOA:Q3JX95"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX95"
FT                   /protein_id="ABA50012.1"
FT                   /translation="MLGRLGTQLAVAFLKFLAVLPYGLTARLGDGLGWLLYQIPSRRKR
FT                   IVHINLQLCFPDWSDARREEIAGRHFRHAIRSYVERSVQWFGSAKKLEKLIQVDSAIDL
FT                   TDPNLPPTLFLGLHFVGIEAGSIWLNRSLQRRCGSLYQPFSNPTLEAIAKAARGRFDAE
FT                   MVGRADSARVVLRWLRDRKPVMLGADMDYGLRNSTFVPFFGVPACTLTAVGRLARTGHA
FT                   QVVPFIGEVLPDYQGYRLKVFKPWENYPTGDDDLDARRMNAFLEEQIPLMPEQYYWVHK
FT                   RFKTRPPGEPGVY"
     MLGRLGTQLA VAFLKFLAVL PYGLTARLGD GLGWLLYQIP SRRKRIVHIN LQLCFPDWSD        60
     ARREEIAGRH FRHAIRSYVE RSVQWFGSAK KLEKLIQVDS AIDLTDPNLP PTLFLGLHFV       120
     GIEAGSIWLN RSLQRRCGSL YQPFSNPTLE AIAKAARGRF DAEMVGRADS ARVVLRWLRD       180
     RKPVMLGADM DYGLRNSTFV PFFGVPACTL TAVGRLARTG HAQVVPFIGE VLPDYQGYRL       240
     KVFKPWENYP TGDDDLDARR MNAFLEEQIP LMPEQYYWVH KRFKTRPPGE PGVY             294
//

If you have problems or comments...

PBIL Back to PBIL home page