(data stored in SCRATCH9089 zone)

EMBL: CP000124.IORA

CP000124.IORA        Location/Qualifiers
FT   CDS             570912..574487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorA"
FT                   /locus_tag="BURPS1710b_0563"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01558"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51105"
FT                   /db_xref="GOA:Q3JWS6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS6"
FT                   /protein_id="ABA51105.1"
FT                   /translation="MNARLPIDGPPALADYRLTDNLSATRGRIFLTGTQALVRLLLMQR
FT                   ALDAAQGVNTAGFVSGYRGSPLGMVDQQLWKAKKQLDASGVRFLPAINEELGGTAVLGT
FT                   QRVEADPQRTVDGVFAMWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSS
FT                   SMPHQSDFAMIAWHMPVVNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTV
FT                   DLDALAMRWPAPEGFAPPEGGLHNRWPDLPSLTIEARLAAKLDAVRHFARANSIDKWIA
FT                   KSARANVGIVTCGKAHLDLMEALRRLDLTAADLDAAGVRIYKVGLSFPLEMTRIDTFVE
FT                   GLAEVLVIEEKGPVIEQQIKDHLYNRAAGARPVVLGKHDAAGAPLLSELGELRPSRILP
FT                   VFAEWLARHKPALDRRARVVDLVAPSILSNEADAVRRTPYFCSGCPHNTSTKVPEGSIA
FT                   QAGIGCHFMASWMERDTTGLIQMGGEGVDWAAHAMFTNTRHVFQNLGDGTYFHSGILAI
FT                   RQAVAARANITYKILYNDAVAMTGGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKY
FT                   DGHHDLFPKGTTFHHRRELDAVQRELRETSGVTVLIYDQTCAAEKRRRRKKGEFPDPDR
FT                   RLFINEAVCEGCGDCGVQSNCLSVEPVETALGRKRRIDQSSCNKDFSCANGFCPSFVTV
FT                   ERATLKKAAGVAFDEAALAARVGALPRPATHLADAPYDMLVTGVGGTGVVTVGALVSMA
FT                   AHLEGKSASVLDFMGFAQKGGAVLSFVRIASSDAWLNQVRIDTQQADVLLACDMVVGAS
FT                   ADALQTVRRERTRIVVNTHAIPNAAFVRDPDASLHADALVEKMRHAAGDGFLARCDAQA
FT                   LATKFLGDTIGANILMLGFAWQQGLVPVSLDAMMRAIELNNVAVPMNKLAFSIGRMAAA
FT                   DAAGLDALWDARHPVHAPPLPQTLDAIVADREARLADYGGARYVARYRALVGAARATGD
FT                   ERLARAVATTFYRLLAVKDEYEVARLYTDGAFRTALEAQFEGAAGKDFRVKFNLAPPAT
FT                   AKAGRHGAAPRKQMFGQWLWPVLGVLARVRGLRGTWLDPFGGTVERKMERALADDYETT
FT                   MHRAFAAHSPQTAELVARLAELHAKVRGYGHVKLANVAGVKRSERELAARLSIDAATSD
FT                   AVRHALDEMKGAGALRGIAVVVAKS"
     MNARLPIDGP PALADYRLTD NLSATRGRIF LTGTQALVRL LLMQRALDAA QGVNTAGFVS        60
     GYRGSPLGMV DQQLWKAKKQ LDASGVRFLP AINEELGGTA VLGTQRVEAD PQRTVDGVFA       120
     MWYGKGPGVD RAGDALKHGN AYGSSPHGGV LVVAGDDHGC VSSSMPHQSD FAMIAWHMPV       180
     VNPSNIADML EFGLYGWALS RYSGAWVGFK AISETVESGS TVDLDALAMR WPAPEGFAPP       240
     EGGLHNRWPD LPSLTIEARL AAKLDAVRHF ARANSIDKWI AKSARANVGI VTCGKAHLDL       300
     MEALRRLDLT AADLDAAGVR IYKVGLSFPL EMTRIDTFVE GLAEVLVIEE KGPVIEQQIK       360
     DHLYNRAAGA RPVVLGKHDA AGAPLLSELG ELRPSRILPV FAEWLARHKP ALDRRARVVD       420
     LVAPSILSNE ADAVRRTPYF CSGCPHNTST KVPEGSIAQA GIGCHFMASW MERDTTGLIQ       480
     MGGEGVDWAA HAMFTNTRHV FQNLGDGTYF HSGILAIRQA VAARANITYK ILYNDAVAMT       540
     GGQPVDGSIS VPQIARQVEA EGVSRFVVVS DEPEKYDGHH DLFPKGTTFH HRRELDAVQR       600
     ELRETSGVTV LIYDQTCAAE KRRRRKKGEF PDPDRRLFIN EAVCEGCGDC GVQSNCLSVE       660
     PVETALGRKR RIDQSSCNKD FSCANGFCPS FVTVERATLK KAAGVAFDEA ALAARVGALP       720
     RPATHLADAP YDMLVTGVGG TGVVTVGALV SMAAHLEGKS ASVLDFMGFA QKGGAVLSFV       780
     RIASSDAWLN QVRIDTQQAD VLLACDMVVG ASADALQTVR RERTRIVVNT HAIPNAAFVR       840
     DPDASLHADA LVEKMRHAAG DGFLARCDAQ ALATKFLGDT IGANILMLGF AWQQGLVPVS       900
     LDAMMRAIEL NNVAVPMNKL AFSIGRMAAA DAAGLDALWD ARHPVHAPPL PQTLDAIVAD       960
     REARLADYGG ARYVARYRAL VGAARATGDE RLARAVATTF YRLLAVKDEY EVARLYTDGA      1020
     FRTALEAQFE GAAGKDFRVK FNLAPPATAK AGRHGAAPRK QMFGQWLWPV LGVLARVRGL      1080
     RGTWLDPFGG TVERKMERAL ADDYETTMHR AFAAHSPQTA ELVARLAELH AKVRGYGHVK      1140
     LANVAGVKRS ERELAARLSI DAATSDAVRH ALDEMKGAGA LRGIAVVVAK S               1191
//

If you have problems or comments...

PBIL Back to PBIL home page