(data stored in SCRATCH9089 zone)

EMBL: CP000124.LIVF

CP000124.LIVF        Location/Qualifiers
FT   CDS             complement(195848..196603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BURPS1710b_0191"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47652"
FT                   /db_xref="GOA:Q3JXU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU6"
FT                   /protein_id="ABA47652.1"
FT                   /translation="MDREAKPVLAVQNLSVRYGKVEALHRAALTVGAGQIVTVIGPNGA
FT                   GKSTLLNAVMGALPTNGHAAGTVLYRGDDVDALPVEQRVALGMCLVPEKRELFGTMSVE
FT                   DNLVLGAYRRKMAGDASFLDQLEPVFSLFPRLKERRKQAAGTLSGGERQMLAVGRALMG
FT                   KPDLLMLDEPSLGLAPLIVKEIFHIISALRGTGVAMLLIEQNARAALQISDYGYVLETG
FT                   EIALEGPAGELAQNPQVIETYLGLARKAV"
     MDREAKPVLA VQNLSVRYGK VEALHRAALT VGAGQIVTVI GPNGAGKSTL LNAVMGALPT        60
     NGHAAGTVLY RGDDVDALPV EQRVALGMCL VPEKRELFGT MSVEDNLVLG AYRRKMAGDA       120
     SFLDQLEPVF SLFPRLKERR KQAAGTLSGG ERQMLAVGRA LMGKPDLLML DEPSLGLAPL       180
     IVKEIFHIIS ALRGTGVAML LIEQNARAAL QISDYGYVLE TGEIALEGPA GELAQNPQVI       240
     ETYLGLARKA V                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page