(data stored in SCRATCH9089 zone)

EMBL: CP000124.LIVH

CP000124.LIVH        Location/Qualifiers
FT   CDS             complement(198395..199450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="BURPS1710b_0193"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49609"
FT                   /db_xref="GOA:Q3JXU4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU4"
FT                   /protein_id="ABA49609.1"
FT                   /translation="MDFSIAAILAQDGITTGAIYALLSLALVLVFSVTRVIFIPQGEFV
FT                   TYGALTLAALQAQKFPATCWLLFVAGIACFMLEVGGLIRHRARRRRLARTLTTLASRYV
FT                   LLPLAIYAVTRSAAAQPLPMIAQIALTLAIVVPLGPFIYRLAYQPIAEGTTLLLLIVSV
FT                   AVHFALVGLGLVMFGAEGSRTTAFSDTSLALGSLSISMQSAWVVGTALVLIAALYLYFE
FT                   RTLPGKALRATSVNRLGARLVGIGTTEAGRLAFTLAAGLGALSGVLVGPLTTIYYDSGF
FT                   LIGLKGFVGAIIGGLVSYPLAAAGSLLVGVLESYSSFWASAYKEVIVFTLIVPVLLWRS
FT                   LAAPQTEDEEA"
     MDFSIAAILA QDGITTGAIY ALLSLALVLV FSVTRVIFIP QGEFVTYGAL TLAALQAQKF        60
     PATCWLLFVA GIACFMLEVG GLIRHRARRR RLARTLTTLA SRYVLLPLAI YAVTRSAAAQ       120
     PLPMIAQIAL TLAIVVPLGP FIYRLAYQPI AEGTTLLLLI VSVAVHFALV GLGLVMFGAE       180
     GSRTTAFSDT SLALGSLSIS MQSAWVVGTA LVLIAALYLY FERTLPGKAL RATSVNRLGA       240
     RLVGIGTTEA GRLAFTLAAG LGALSGVLVG PLTTIYYDSG FLIGLKGFVG AIIGGLVSYP       300
     LAAAGSLLVG VLESYSSFWA SAYKEVIVFT LIVPVLLWRS LAAPQTEDEE A                351
//

If you have problems or comments...

PBIL Back to PBIL home page