(data stored in SCRATCH9089 zone)

EMBL: CP000124.LON1

CP000124.LON1        Location/Qualifiers
FT   CDS             445202..446182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon1"
FT                   /locus_tag="BURPS1710b_0433"
FT                   /product="ATP-dependent protease domain protein"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48187"
FT                   /db_xref="GOA:Q3JX56"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX56"
FT                   /protein_id="ABA48187.1"
FT                   /translation="MTTAMVKQELAVASFSTVYDIERIETALNDLNEGASDALRATYEK
FT                   MLKTGNLRFCVKPTRMPAFDSLAQALPNFAEPLDDVRKQVALCLETDDRLELMPILLLG
FT                   EPGIGKTHFAKALAKMLGTAYHYVPMSSLTAGWVLSGASSQWKNAKPGKVFDALVNGCY
FT                   SNPVIAIDEIDKAGSDAQYDPLGALYALLEHDTASAFVDEFAEVPIDAGNVIWIATAND
FT                   ASAIPEPIMNRMNVYEIEPPDASGARRIAQTIYGEIRNAHAWGQRFPAALGDDALDVLA
FT                   AMPPRTMRRVLLHAFGAARLDGRDAVAPRDIRTDESAGRRRPIGF"
     MTTAMVKQEL AVASFSTVYD IERIETALND LNEGASDALR ATYEKMLKTG NLRFCVKPTR        60
     MPAFDSLAQA LPNFAEPLDD VRKQVALCLE TDDRLELMPI LLLGEPGIGK THFAKALAKM       120
     LGTAYHYVPM SSLTAGWVLS GASSQWKNAK PGKVFDALVN GCYSNPVIAI DEIDKAGSDA       180
     QYDPLGALYA LLEHDTASAF VDEFAEVPID AGNVIWIATA NDASAIPEPI MNRMNVYEIE       240
     PPDASGARRI AQTIYGEIRN AHAWGQRFPA ALGDDALDVL AAMPPRTMRR VLLHAFGAAR       300
     LDGRDAVAPR DIRTDESAGR RRPIGF                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page