(data stored in SCRATCH9089 zone)

EMBL: CP000124.LRP

CP000124.LRP         Location/Qualifiers
FT   CDS             complement(14837..15352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_0015"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48060"
FT                   /db_xref="GOA:Q3JYC0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC0"
FT                   /protein_id="ABA48060.1"
FT                   /translation="MAHVELDAIDRRILSILQENGRLSNQDIAERVNLSPSPCLRRIRR
FT                   LEEMGVITGYVALLDPQKLGLDLLAYVSVRLEKRGGVAPVRGDETSARAGATHAELFRA
FT                   AVQAWPEVVACHAMTGDMDYLLRVQVEDMAHFSRFMQEQLLHHPSVIDVKTSFSLERFK
FT                   ETTALPIR"
     MAHVELDAID RRILSILQEN GRLSNQDIAE RVNLSPSPCL RRIRRLEEMG VITGYVALLD        60
     PQKLGLDLLA YVSVRLEKRG GVAPVRGDET SARAGATHAE LFRAAVQAWP EVVACHAMTG       120
     DMDYLLRVQV EDMAHFSRFM QEQLLHHPSV IDVKTSFSLE RFKETTALPI R                171
//

If you have problems or comments...

PBIL Back to PBIL home page