(data stored in SCRATCH9089 zone)

EMBL: CP000124.MAEB-2

CP000124.MAEB-2      Location/Qualifiers
FT   CDS             complement(21504..23825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB-2"
FT                   /locus_tag="BURPS1710b_0019"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF01515; match to protein
FT                   family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47480"
FT                   /db_xref="GOA:Q3JYB6"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB6"
FT                   /protein_id="ABA47480.1"
FT                   /translation="MLGTESSKITHVSRRSTMDEQLKQSALAYHQNPKPGKISVTPTKP
FT                   LSNQLDLSLAYSPGVAAACEAIHADPLDAQKYTSRGNLVGVVTNGTAVLGLGNIGPLAA
FT                   KPVMEGKGCLFKKFAGIDVFDIELAESDPDKLVEAIAMLEPTLGGINLEDIKAPECFYI
FT                   EQKLRERMKIPVFHDDQHGTAIIASAAILNGLKVVGKDLSSVKLVCSGAGAAAIACLDL
FT                   LVKLGLSKSNVLVADSKGVIYEGRGNLDPSKQRYAATTGARTLADAIAGADVFLGCSSA
FT                   GVLKQDMVKTMADRPLILALANPEPEIRPEDAKAVRPDAIVATGRSDYPNQVNNVLCFP
FT                   FIFRGALDVGATTITEEMKLACVRAIAELAQETDQSEEVAKAYEGHSLEFGPEYLIPKP
FT                   FDPRLIIKIAPAVAQAAMDSGVATRPIADMDAYREQLGTTVYRTGMVMRPVFATAKTKA
FT                   ARIVFAEGEDERVLRAAQFVLQERIAKPIIVGRPSVVEMRLKKIGSKLVGGVDFEIVNP
FT                   EDDPRYQQCWQAYHEIGARDGVTPEVAKAALRKFNTLIGAMLVHLGDAHGMICGMIDTY
FT                   HSHLKFIEQVLGRAKGAEHFAAMNLLMLPGRNLFMCDTYVNEQPSAEQLADMTIQAAAE
FT                   IERFGITPKAALLSNSNFGSAPSASSRRMAEARKLIVERAPELEVDGEMHGDAALSEVV
FT                   RKAAFPGTTLTGEANLLIMPNVEAANIAYNLLKMVGGEGVTVGPFLLGAAKPVHILTPA
FT                   ATVRRIINMTAVAAANVQVK"
     MLGTESSKIT HVSRRSTMDE QLKQSALAYH QNPKPGKISV TPTKPLSNQL DLSLAYSPGV        60
     AAACEAIHAD PLDAQKYTSR GNLVGVVTNG TAVLGLGNIG PLAAKPVMEG KGCLFKKFAG       120
     IDVFDIELAE SDPDKLVEAI AMLEPTLGGI NLEDIKAPEC FYIEQKLRER MKIPVFHDDQ       180
     HGTAIIASAA ILNGLKVVGK DLSSVKLVCS GAGAAAIACL DLLVKLGLSK SNVLVADSKG       240
     VIYEGRGNLD PSKQRYAATT GARTLADAIA GADVFLGCSS AGVLKQDMVK TMADRPLILA       300
     LANPEPEIRP EDAKAVRPDA IVATGRSDYP NQVNNVLCFP FIFRGALDVG ATTITEEMKL       360
     ACVRAIAELA QETDQSEEVA KAYEGHSLEF GPEYLIPKPF DPRLIIKIAP AVAQAAMDSG       420
     VATRPIADMD AYREQLGTTV YRTGMVMRPV FATAKTKAAR IVFAEGEDER VLRAAQFVLQ       480
     ERIAKPIIVG RPSVVEMRLK KIGSKLVGGV DFEIVNPEDD PRYQQCWQAY HEIGARDGVT       540
     PEVAKAALRK FNTLIGAMLV HLGDAHGMIC GMIDTYHSHL KFIEQVLGRA KGAEHFAAMN       600
     LLMLPGRNLF MCDTYVNEQP SAEQLADMTI QAAAEIERFG ITPKAALLSN SNFGSAPSAS       660
     SRRMAEARKL IVERAPELEV DGEMHGDAAL SEVVRKAAFP GTTLTGEANL LIMPNVEAAN       720
     IAYNLLKMVG GEGVTVGPFL LGAAKPVHIL TPAATVRRII NMTAVAAANV QVK              773
//

If you have problems or comments...

PBIL Back to PBIL home page