(data stored in SCRATCH9089 zone)

EMBL: CP000124.METF

CP000124.METF        Location/Qualifiers
FT   CDS             complement(59305..60135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="BURPS1710b_0055"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="identified by match to protein family HMM PF02219;
FT                   match to protein family HMM TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49953"
FT                   /db_xref="GOA:Q3JY81"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY81"
FT                   /protein_id="ABA49953.1"
FT                   /translation="MNPIELSFEFFPPKTAEGVDKLRATRAQLAPLKPKFVSVTFGAGG
FT                   STQQGTLDTVLDMQKAGLEAAPHLSCIGSSKDSLRAILDQYRSHGIRHIVALRGDLPSG
FT                   MGEVGELRYASELVSFIRAEHGDWFRIEVAAYPEYHPQARSPKADLENFARKVKAGANA
FT                   AITQYFYNADAYFRFVDDAAKLGVDVPVVPGIMPITNFSQLMRFSEMCGAEVPRWVARR
FT                   LESFGDDKDSIRAFGADVVTGLCRRLIDAGVPGLHFYTLNGAAATKTVCERLGL"
     MNPIELSFEF FPPKTAEGVD KLRATRAQLA PLKPKFVSVT FGAGGSTQQG TLDTVLDMQK        60
     AGLEAAPHLS CIGSSKDSLR AILDQYRSHG IRHIVALRGD LPSGMGEVGE LRYASELVSF       120
     IRAEHGDWFR IEVAAYPEYH PQARSPKADL ENFARKVKAG ANAAITQYFY NADAYFRFVD       180
     DAAKLGVDVP VVPGIMPITN FSQLMRFSEM CGAEVPRWVA RRLESFGDDK DSIRAFGADV       240
     VTGLCRRLID AGVPGLHFYT LNGAAATKTV CERLGL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page