(data stored in SCRATCH9089 zone)

EMBL: CP000124.METH

CP000124.METH        Location/Qualifiers
FT   CDS             complement(608170..610887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="BURPS1710b_0594"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM PF02310; match to protein
FT                   family HMM PF02607; match to protein family HMM PF02965;
FT                   match to protein family HMM TIGR02082"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48367"
FT                   /db_xref="GOA:Q3JWP5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP5"
FT                   /protein_id="ABA48367.1"
FT                   /translation="MTDHTMRLAGLEPFNVTSGTLFINVGERTNVTGSKAFARMILNGQ
FT                   FDEALAVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIARVPIMIDSSKW
FT                   DVIEAGLKCVQGKAIVNSISLKEGKEAFVHHAKLIRRYGAAAVVMAFDEAGQADTLARK
FT                   TEICKRSYDVLVNEVGFAPEDIVFDPNIFAVATGIDEHNNYAVDFIEATRWIKRNLPYA
FT                   KVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYAELDAELRER
FT                   VEDVILNRRDDSTDRLLEIADKFKTGAAKKEENLEWRSQPVEKRLAHALVHGITNFIVE
FT                   DTEEARAKIAAAGGRPINVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHL
FT                   IPFIEEEKRLLAQAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMV
FT                   PCNEILAKAKVEGADIVGLSGLITPSLEEMAYVASEMQRDDYFRVKKIPLLIGGATTSR
FT                   VHTAVKIAPHYEGPVVYVPDASRSVSVASNLLSDEGATKYLDELKADYERIRAQHANKK
FT                   ALPLVTLAEARANKTKIDWARYTSVKPKFIGRRMFKNYDLNELANYIDWGPFFQTWDLA
FT                   GPYPAILNDEIVGESARRVFSDAKSMLARLIQGRWLTANGVIALLPANTVGDDDIEIYT
FT                   DDTRAEVLLTWHNLRQQSVRPVVDGVMRPNRSLADFIAPKDSGVADYIGMFAVTAGIGV
FT                   DAKEKQFLADHDDYSAIMLKALADRLAEAFAEAMHARVRRELWGYAATEQLDNDALIAE
FT                   QYAGIRPAPGYPACPDHLVKRAMFEALHTDEIGMSVTDSLAMLPAASVSGFYLAHPDST
FT                   YFSVGKIGQDQLEDFARRTALSKADAERALAPLL"
     MTDHTMRLAG LEPFNVTSGT LFINVGERTN VTGSKAFARM ILNGQFDEAL AVARQQVENG        60
     AQVIDVNMDE AMLDSKAAMV RFLNLIASEP DIARVPIMID SSKWDVIEAG LKCVQGKAIV       120
     NSISLKEGKE AFVHHAKLIR RYGAAAVVMA FDEAGQADTL ARKTEICKRS YDVLVNEVGF       180
     APEDIVFDPN IFAVATGIDE HNNYAVDFIE ATRWIKRNLP YAKVSGGVSN VSFSFRGNDP       240
     VREAIHTVFL YHAIQAGMDM GIVNAGQLGV YAELDAELRE RVEDVILNRR DDSTDRLLEI       300
     ADKFKTGAAK KEENLEWRSQ PVEKRLAHAL VHGITNFIVE DTEEARAKIA AAGGRPINVI       360
     EGPLMDGMNI VGDLFGQGKM FLPQVVKSAR VMKQAVAHLI PFIEEEKRLL AQAGGDVRAK       420
     GKIVIATVKG DVHDIGKNIV SVVLQCNNFE VVNMGVMVPC NEILAKAKVE GADIVGLSGL       480
     ITPSLEEMAY VASEMQRDDY FRVKKIPLLI GGATTSRVHT AVKIAPHYEG PVVYVPDASR       540
     SVSVASNLLS DEGATKYLDE LKADYERIRA QHANKKALPL VTLAEARANK TKIDWARYTS       600
     VKPKFIGRRM FKNYDLNELA NYIDWGPFFQ TWDLAGPYPA ILNDEIVGES ARRVFSDAKS       660
     MLARLIQGRW LTANGVIALL PANTVGDDDI EIYTDDTRAE VLLTWHNLRQ QSVRPVVDGV       720
     MRPNRSLADF IAPKDSGVAD YIGMFAVTAG IGVDAKEKQF LADHDDYSAI MLKALADRLA       780
     EAFAEAMHAR VRRELWGYAA TEQLDNDALI AEQYAGIRPA PGYPACPDHL VKRAMFEALH       840
     TDEIGMSVTD SLAMLPAASV SGFYLAHPDS TYFSVGKIGQ DQLEDFARRT ALSKADAERA       900
     LAPLL                                                                   905
//

If you have problems or comments...

PBIL Back to PBIL home page