(data stored in SCRATCH9089 zone)

EMBL: CP000124.METX

CP000124.METX        Location/Qualifiers
FT   CDS             complement(394503..395648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="BURPS1710b_0377"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50518"
FT                   /db_xref="GOA:Q3JXB2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXB2"
FT                   /protein_id="ABA50518.1"
FT                   /translation="MESIGVVAPHTMHFAEPLRLQSGSVLGNYQLVVETYGELNAVRSN
FT                   AVLVCHALNASHHVAGVYADDPRSTGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTG
FT                   PMNIDPATGTPYGARFPVVTVEDWVHAQARVADALGIERFAAVMGGSLGGMQALAWSLL
FT                   YPERVAHCIDIASTPKLSAQNIAFNEVARSAILSDPDFHGGDYYAHGVKPRRGLRVARM
FT                   IGHITYLSDDDMAEKFGRALRRADGALDAYNFNFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAFNGDLSAALAHTKAKYLIASFMTDWRFAPARSREIVKALLDNR
FT                   RSVSYAEIDAPHGHDAFLLDDARYHNLVRAYYERIAEEVGA"
     MESIGVVAPH TMHFAEPLRL QSGSVLGNYQ LVVETYGELN AVRSNAVLVC HALNASHHVA        60
     GVYADDPRST GWWDNMVGPG KPLDTNRFFV IGVNNLGSCF GSTGPMNIDP ATGTPYGARF       120
     PVVTVEDWVH AQARVADALG IERFAAVMGG SLGGMQALAW SLLYPERVAH CIDIASTPKL       180
     SAQNIAFNEV ARSAILSDPD FHGGDYYAHG VKPRRGLRVA RMIGHITYLS DDDMAEKFGR       240
     ALRRADGALD AYNFNFDVEF EVESYLRYQG DKFADYFDAN TYLLITRALD YFDPAKAFNG       300
     DLSAALAHTK AKYLIASFMT DWRFAPARSR EIVKALLDNR RSVSYAEIDA PHGHDAFLLD       360
     DARYHNLVRA YYERIAEEVG A                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page