(data stored in SCRATCH9089 zone)

EMBL: CP000124.MMSA

CP000124.MMSA        Location/Qualifiers
FT   CDS             complement(210039..211565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="BURPS1710b_0202"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47947"
FT                   /db_xref="GOA:Q3JXT5"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT5"
FT                   /protein_id="ABA47947.1"
FT                   /translation="MTGSTHSNDSRVRALAHFIGGRALDGASDRYGDVFDPALGTVTAR
FT                   VPLASGAEVDAAVAAAAAAFPAWSETSPLKRARVMFKFKELLDRHHDELAELITREHGK
FT                   VFSDAKGEVMRGIEVVEFACGIPNLLKTDFTDQIGGGIDNWNLRQPLGVVAGITPFNFP
FT                   MMVPCWMFPVAIACGNTFVLKPSERDPSASIRLAELLKEAGLPDGVFNVVHGDKTAVDA
FT                   LIAHPDVAALSFVGSTPIAEYIHTQAARRGKRVQALGGAKNHLVVMPDANLDQAVDALV
FT                   GAAYGSAGERCMAISVAVAVGGVADALVERLAERAKALKIGNGMNADVEMGPLVTAAHR
FT                   AKVSAYIDAGVAAGAKLVVDGRRHVVAGGENGFFLGGTLFDDVTTDMSIYREEIFGPVL
FT                   AVVRVPDFASAVELINAHEFANGVSCFTSDGGIARAFARKIQVGMVGINVPIPVPMAWH
FT                   SFGGWKRSLFGDHHAYGEEGVRFYTRYKSVMQRWPDSIAKGAEFTMPVAK"
     MTGSTHSNDS RVRALAHFIG GRALDGASDR YGDVFDPALG TVTARVPLAS GAEVDAAVAA        60
     AAAAFPAWSE TSPLKRARVM FKFKELLDRH HDELAELITR EHGKVFSDAK GEVMRGIEVV       120
     EFACGIPNLL KTDFTDQIGG GIDNWNLRQP LGVVAGITPF NFPMMVPCWM FPVAIACGNT       180
     FVLKPSERDP SASIRLAELL KEAGLPDGVF NVVHGDKTAV DALIAHPDVA ALSFVGSTPI       240
     AEYIHTQAAR RGKRVQALGG AKNHLVVMPD ANLDQAVDAL VGAAYGSAGE RCMAISVAVA       300
     VGGVADALVE RLAERAKALK IGNGMNADVE MGPLVTAAHR AKVSAYIDAG VAAGAKLVVD       360
     GRRHVVAGGE NGFFLGGTLF DDVTTDMSIY REEIFGPVLA VVRVPDFASA VELINAHEFA       420
     NGVSCFTSDG GIARAFARKI QVGMVGINVP IPVPMAWHSF GGWKRSLFGD HHAYGEEGVR       480
     FYTRYKSVMQ RWPDSIAKGA EFTMPVAK                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page