(data stored in SCRATCH9089 zone)

EMBL: CP000124.MOD

CP000124.MOD         Location/Qualifiers
FT   CDS             264836..266869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mod"
FT                   /locus_tag="BURPS1710b_0259"
FT                   /product="type III DNA modification methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50296"
FT                   /db_xref="GOA:Q3JXM8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM8"
FT                   /protein_id="ABA50296.1"
FT                   /translation="MQLMGRMMQKLDAASPEAQSADLVAANVERLKALFPDVVTEGPDG
FT                   ASVNLDALAALVGASAAAAADADEKYGLNWHGKRRARRLALTPSTGTLRPCPRESAGWA
FT                   STRNLMIEGENLEVLKLLQKSYAGRVKLVYIDPPYNTGKDFVYPDNFTDSLRHYLELTG
FT                   QTTGGKRVTSHTDASGRFHTDWLNMIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVM
FT                   REIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAERLFERAPLKRPKRNAQR
FT                   MLGAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYDRISADGRVYRLVSMAWPNK
FT                   KKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMRALIDKGLVEFGADETTQPQRIYFL
FT                   DENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGS
FT                   GTTAHAVMALNAADGGHRRYVLVQLPEPLDADSKDQKAAADFCAAQRVPLNLAELTKER
FT                   LRRAAARIAAEHPGTRADLGFRVFRLDSTNVSEWDPRGDDIQQSLFAAVEHIKPNRSEE
FT                   DLLYELMLKLGLDLCAPIDARMIAGKAVYVIDGAIVACFDAHIDRASTDALGEGIVGLI
FT                   AEAADAREVTCVFRDSGFADDVAKVNLSAILEQHGVKRIRSL"
     MQLMGRMMQK LDAASPEAQS ADLVAANVER LKALFPDVVT EGPDGASVNL DALAALVGAS        60
     AAAAADADEK YGLNWHGKRR ARRLALTPST GTLRPCPRES AGWASTRNLM IEGENLEVLK       120
     LLQKSYAGRV KLVYIDPPYN TGKDFVYPDN FTDSLRHYLE LTGQTTGGKR VTSHTDASGR       180
     FHTDWLNMIY PRLKLARDLL TEDGVIAVHI DEHEQHALVL VMREIFGEDN ELGVAVWDKR       240
     NPKGDARGIA YQHESIVLFA RDAERLFERA PLKRPKRNAQ RMLGAAREAV AGAATIADAN       300
     AAYRGWVKSQ TTLSGGEAMY DRISADGRVY RLVSMAWPNK KKAPDDYFVP LVHPVTGKPC       360
     PVPERGWRNP PATMRALIDK GLVEFGADET TQPQRIYFLD ENMYENVPSV LPFGGSDDAL       420
     MKSLGIPFDQ PKPVEFAASI IGWCTDGDDL IVDFFGGSGT TAHAVMALNA ADGGHRRYVL       480
     VQLPEPLDAD SKDQKAAADF CAAQRVPLNL AELTKERLRR AAARIAAEHP GTRADLGFRV       540
     FRLDSTNVSE WDPRGDDIQQ SLFAAVEHIK PNRSEEDLLY ELMLKLGLDL CAPIDARMIA       600
     GKAVYVIDGA IVACFDAHID RASTDALGEG IVGLIAEAAD AREVTCVFRD SGFADDVAKV       660
     NLSAILEQHG VKRIRSL                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page