(data stored in SCRATCH9089 zone)

EMBL: CP000124.MOTB

CP000124.MOTB        Location/Qualifiers
FT   CDS             complement(82067..83089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BURPS1710b_0079"
FT                   /product="MotB"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48892"
FT                   /db_xref="GOA:Q3JY57"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY57"
FT                   /protein_id="ABA48892.1"
FT                   /translation="MSKGKDQAIIVKRVNQQKKGHHGGAWKLAYADFMTAMMAFFLLMW
FT                   LLSAVTPVQLKGIAEYFNTPLKAAIFGSGDRSADDASIIKGGGRDISSLDAGTTRRTDG
FT                   STHLAERVAKKSEDDALAQAQGSLERREQVRLHDLQVKLMAAIEANPTLRQFKQQIRID
FT                   STLMGLRIEIVDTQKRPMFAMSSDAVEPYMRDILREIGKTLNDVPNRIIVQGHTDAVPY
FT                   AGGEKGYSNWELSADRANASRRELIAGGMDEAKVLRVLGLASTQNLNKADPLDPENRRI
FT                   SIIVLNRKSELALMRDDATTTTLSSDAAGSARLAQQITPPGAAAMPALPGASGLAVQKP
FT                   "
     MSKGKDQAII VKRVNQQKKG HHGGAWKLAY ADFMTAMMAF FLLMWLLSAV TPVQLKGIAE        60
     YFNTPLKAAI FGSGDRSADD ASIIKGGGRD ISSLDAGTTR RTDGSTHLAE RVAKKSEDDA       120
     LAQAQGSLER REQVRLHDLQ VKLMAAIEAN PTLRQFKQQI RIDSTLMGLR IEIVDTQKRP       180
     MFAMSSDAVE PYMRDILREI GKTLNDVPNR IIVQGHTDAV PYAGGEKGYS NWELSADRAN       240
     ASRRELIAGG MDEAKVLRVL GLASTQNLNK ADPLDPENRR ISIIVLNRKS ELALMRDDAT       300
     TTTLSSDAAG SARLAQQITP PGAAAMPALP GASGLAVQKP                             340
//

If you have problems or comments...

PBIL Back to PBIL home page