(data stored in SCRATCH9089 zone)

EMBL: CP000124.MRDB

CP000124.MRDB        Location/Qualifiers
FT   CDS             complement(376618..377766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="BURPS1710b_0362"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49226"
FT                   /db_xref="GOA:Q3JXC7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC7"
FT                   /protein_id="ABA49226.1"
FT                   /translation="MQFDKRASLDKIKQMFAGFDRPLALIVFLLLCVGIVTLYSASVDV
FT                   PGRVEDQLRNIMLTFVLMWMIANIPPQTLMRFAVPLYSFGVALLVAVALFGMTKKGAKR
FT                   WLNVGVVIQPSEILKIATPLMLAWYYQRRESSLRWYDFVVAFAILMVPVGLIAKQPDLG
FT                   TAVLVFAAGLFVIYLAGLSFKLIVPVLVAGVLAVGSIAVFEERICQPEVVWPLMHDYQK
FT                   HRVCTLLDPTSDPLGKGFHTIQAVIAIGSGGPLGKGYLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEFGLVGGLVLLTLYMALIARGLYIAAQGATLFGRLLAGSLTLAFFVYAFVNIGMVS
FT                   GVLPVVGVPLPFMSYGGTALTTLGIAVGLIMSVGRQKRLMKS"
     MQFDKRASLD KIKQMFAGFD RPLALIVFLL LCVGIVTLYS ASVDVPGRVE DQLRNIMLTF        60
     VLMWMIANIP PQTLMRFAVP LYSFGVALLV AVALFGMTKK GAKRWLNVGV VIQPSEILKI       120
     ATPLMLAWYY QRRESSLRWY DFVVAFAILM VPVGLIAKQP DLGTAVLVFA AGLFVIYLAG       180
     LSFKLIVPVL VAGVLAVGSI AVFEERICQP EVVWPLMHDY QKHRVCTLLD PTSDPLGKGF       240
     HTIQAVIAIG SGGPLGKGYL KGTQAHLEFI PEKHTDFIFA VFSEEFGLVG GLVLLTLYMA       300
     LIARGLYIAA QGATLFGRLL AGSLTLAFFV YAFVNIGMVS GVLPVVGVPL PFMSYGGTAL       360
     TTLGIAVGLI MSVGRQKRLM KS                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page