(data stored in SCRATCH9089 zone)

EMBL: CP000124.MREC

CP000124.MREC        Location/Qualifiers
FT   CDS             complement(380882..381955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="BURPS1710b_0365"
FT                   /product="rod shape-determining protein"
FT                   /note="identified by match to protein family HMM PF04085;
FT                   match to protein family HMM TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48228"
FT                   /db_xref="GOA:Q3JXC4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC4"
FT                   /protein_id="ABA48228.1"
FT                   /translation="MEYSPPPLFKQGPSALARLIFFVVLAIALLVSDARFNTLEIVRGV
FT                   LGTVLYPLQRAALVPRDLIVGAAELATSSTALRHENQQLRDRNLKLSLQANQAGQLAAD
FT                   NAHLRAVLELRQQIAAQATPVEIQYDTGDPFSQKIIIGHGSQAGIQDGAPVVNEDGVIG
FT                   QVTRVFPLQSEVTLVTDRDLAIPVQVLRTGLRSVIYGTPKGDALDLRFVPTSADLLAGD
FT                   ELVTSGLDGVYPPGLPVAKVVRVDKLADTAFAHVVCAPIAAVRGAREMLVLHYRNDIPP
FT                   PPVTDDAASDAKAAKGKKATKGADKSAKAADKGADKDKGAKPAAAPPVPARSRPAGPAQ
FT                   PAAPLKPATAPSPGAPR"
     MEYSPPPLFK QGPSALARLI FFVVLAIALL VSDARFNTLE IVRGVLGTVL YPLQRAALVP        60
     RDLIVGAAEL ATSSTALRHE NQQLRDRNLK LSLQANQAGQ LAADNAHLRA VLELRQQIAA       120
     QATPVEIQYD TGDPFSQKII IGHGSQAGIQ DGAPVVNEDG VIGQVTRVFP LQSEVTLVTD       180
     RDLAIPVQVL RTGLRSVIYG TPKGDALDLR FVPTSADLLA GDELVTSGLD GVYPPGLPVA       240
     KVVRVDKLAD TAFAHVVCAP IAAVRGAREM LVLHYRNDIP PPPVTDDAAS DAKAAKGKKA       300
     TKGADKSAKA ADKGADKDKG AKPAAAPPVP ARSRPAGPAQ PAAPLKPATA PSPGAPR          357
//

If you have problems or comments...

PBIL Back to PBIL home page