(data stored in SCRATCH9089 zone)

EMBL: CP000124.MRED

CP000124.MRED        Location/Qualifiers
FT   CDS             complement(380373..380885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="BURPS1710b_0364"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="identified by match to protein family HMM PF04093"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49284"
FT                   /db_xref="GOA:Q3JXC5"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC5"
FT                   /protein_id="ABA49284.1"
FT                   /translation="MSRPQYILQPVNPYFIVFSLAAAFLLNLMPWGRVPGVPDCVALVL
FT                   LFWNIHQPRKVGMGVAFALGILMDVHDAGLLGEHALAYTLLSYGAITIHRRVLWLPLGV
FT                   QIFYVAPLLVIAQLVPFVIRLLMGAAFPGWSYLVDGFVEAALWPVASHLLLMPQRRPVD
FT                   PDDTRPI"
     MSRPQYILQP VNPYFIVFSL AAAFLLNLMP WGRVPGVPDC VALVLLFWNI HQPRKVGMGV        60
     AFALGILMDV HDAGLLGEHA LAYTLLSYGA ITIHRRVLWL PLGVQIFYVA PLLVIAQLVP       120
     FVIRLLMGAA FPGWSYLVDG FVEAALWPVA SHLLLMPQRR PVDPDDTRPI                  170
//

If you have problems or comments...

PBIL Back to PBIL home page