(data stored in SCRATCH9089 zone)

EMBL: CP000124.NYLA

CP000124.NYLA        Location/Qualifiers
FT   CDS             57631..59121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nylA"
FT                   /locus_tag="BURPS1710b_0054"
FT                   /product="6-aminohexanoate-cyclic-dimer hydrolase"
FT                   /EC_number="3.5.2.12"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50489"
FT                   /db_xref="GOA:Q3JY82"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY82"
FT                   /protein_id="ABA50489.1"
FT                   /translation="MTVLSDYLCHDAIGLAQLVAQREVSARELLDAAIGRAQALNPAIN
FT                   AIVLNDYAAARERAASGTLAGPLAGVPYLVKDLGSAVAGLPLSLGSRHYRHHVPAEDSP
FT                   LIVRTKAAGLNIFGKTNTPELGQMPYTESALLGVCRNPWNLDHTPGGSSGGAAAAVAAG
FT                   IVPLAHASDGGGSIRIPASCCGLFGFKPSRDPALTPWPVPGEIVVEHAVSRSVRDSALL
FT                   LDITTGRTAPGTLEGVGAPGTYLGALDAPPPALKIGYVTDPMLAPALSADVRDALDRAA
FT                   ALAASLGHNVEPATLNLDFAQIGEVFLTIWAAIADELVLGAERITGRKPARAEFEPATW
FT                   AMAQVGRRLVRERLPHALELQRQITARVAGLVSRYDVLLCATLAAPPIKIGEMQPTPLE
FT                   TRQMELLGVLPIKPLLKRMLAEVSHQAFAWAGCTELFNLTGQPAMSVPLHWSARGLPVG
FT                   VQFVARHGDDARLFALARQLELAQPWFDKRPPLARAQA"
     MTVLSDYLCH DAIGLAQLVA QREVSARELL DAAIGRAQAL NPAINAIVLN DYAAARERAA        60
     SGTLAGPLAG VPYLVKDLGS AVAGLPLSLG SRHYRHHVPA EDSPLIVRTK AAGLNIFGKT       120
     NTPELGQMPY TESALLGVCR NPWNLDHTPG GSSGGAAAAV AAGIVPLAHA SDGGGSIRIP       180
     ASCCGLFGFK PSRDPALTPW PVPGEIVVEH AVSRSVRDSA LLLDITTGRT APGTLEGVGA       240
     PGTYLGALDA PPPALKIGYV TDPMLAPALS ADVRDALDRA AALAASLGHN VEPATLNLDF       300
     AQIGEVFLTI WAAIADELVL GAERITGRKP ARAEFEPATW AMAQVGRRLV RERLPHALEL       360
     QRQITARVAG LVSRYDVLLC ATLAAPPIKI GEMQPTPLET RQMELLGVLP IKPLLKRMLA       420
     EVSHQAFAWA GCTELFNLTG QPAMSVPLHW SARGLPVGVQ FVARHGDDAR LFALARQLEL       480
     AQPWFDKRPP LARAQA                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page