(data stored in SCRATCH9089 zone)

EMBL: CP000124.OMPW

CP000124.OMPW        Location/Qualifiers
FT   CDS             31191..32021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompW"
FT                   /locus_tag="BURPS1710b_0026"
FT                   /product="outer membrane protein, OmpW family"
FT                   /note="identified by match to protein family HMM PF03922"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50615"
FT                   /db_xref="GOA:Q3JYA9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA9"
FT                   /protein_id="ABA50615.1"
FT                   /translation="MRKALCTALGVAALTPLAAHAQSAGSNVVTLGWFHVMPQQSSTPL
FT                   TTNVAPTPINTPLRLPPSFTSAGTGLSTSGADTVGLTVSHFLTDHIAVTSVAGVPPVFK
FT                   VSGHGTITPPGPAGALGTQNIGLAQVNPIVKSVRQWSPAVVFQYYFAQATAKFRPFVGI
FT                   GVSYNWFSDLQLNTNFIKQTQDNLGAILAAGAGKPGVTQVSAKASSSWQPVFNAGLSYN
FT                   ITDHWGLVASVTYIPLKTTSTVTIKAADGTTLAESKSDLKADPIISYVAVSYKF"
     MRKALCTALG VAALTPLAAH AQSAGSNVVT LGWFHVMPQQ SSTPLTTNVA PTPINTPLRL        60
     PPSFTSAGTG LSTSGADTVG LTVSHFLTDH IAVTSVAGVP PVFKVSGHGT ITPPGPAGAL       120
     GTQNIGLAQV NPIVKSVRQW SPAVVFQYYF AQATAKFRPF VGIGVSYNWF SDLQLNTNFI       180
     KQTQDNLGAI LAAGAGKPGV TQVSAKASSS WQPVFNAGLS YNITDHWGLV ASVTYIPLKT       240
     TSTVTIKAAD GTTLAESKSD LKADPIISYV AVSYKF                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page