(data stored in SCRATCH9089 zone)

EMBL: CP000124.OPMB

CP000124.OPMB        Location/Qualifiers
FT   CDS             complement(243225..244841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opmB"
FT                   /locus_tag="BURPS1710b_0232"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50714"
FT                   /db_xref="GOA:Q3JXQ5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ5"
FT                   /protein_id="ABA50714.1"
FT                   /translation="MPQVPHPRARRALSAAVAAATAVLLAGCAVGPDYHRPDAAIPAAY
FT                   KEAPPGWKLAQPADRADRGPWWSIYDDAQLNALIDKLNASNQTVAQYAAAYRQARALVA
FT                   EARASYFPTLGLTASESRASSALSSGTASRGTTRTVGNTYSVGLDASWEPDLWGKVSRT
FT                   VGAQKAGEAAAAADLANARLSAQATLAQTYFQLRAADATQKLLDDTVESYRKSLQLTQN
FT                   QYAQGVAARADVIQAQTQLQSAQAAAIDNGIARAQYEHAIATLVGEPAPTFSLPPMPLT
FT                   AEPPAMPIDVPSAILERRPDVAAAERRAAAANEQIGVAIAAFFPTLTLSASGGFQSSVW
FT                   SQLFTLPARFWSVGPQLAATLFDAGLRAAQTEAARATYDQDVAAYRAAVLSAFQDVEDN
FT                   LASQRILEQEIVVQRQAVESAQHSLDITLNQYKAGTVGYLNVLTAQTTAFSARQKLAAL
FT                   SGQRMVSSVGLVKALGGGWDGSQIARETGGMQAPAAPAGASAPAAMPAAAVAPAARPAA
FT                   VVAAAGPDTQARRPRATPAAQ"
     MPQVPHPRAR RALSAAVAAA TAVLLAGCAV GPDYHRPDAA IPAAYKEAPP GWKLAQPADR        60
     ADRGPWWSIY DDAQLNALID KLNASNQTVA QYAAAYRQAR ALVAEARASY FPTLGLTASE       120
     SRASSALSSG TASRGTTRTV GNTYSVGLDA SWEPDLWGKV SRTVGAQKAG EAAAAADLAN       180
     ARLSAQATLA QTYFQLRAAD ATQKLLDDTV ESYRKSLQLT QNQYAQGVAA RADVIQAQTQ       240
     LQSAQAAAID NGIARAQYEH AIATLVGEPA PTFSLPPMPL TAEPPAMPID VPSAILERRP       300
     DVAAAERRAA AANEQIGVAI AAFFPTLTLS ASGGFQSSVW SQLFTLPARF WSVGPQLAAT       360
     LFDAGLRAAQ TEAARATYDQ DVAAYRAAVL SAFQDVEDNL ASQRILEQEI VVQRQAVESA       420
     QHSLDITLNQ YKAGTVGYLN VLTAQTTAFS ARQKLAALSG QRMVSSVGLV KALGGGWDGS       480
     QIARETGGMQ APAAPAGASA PAAMPAAAVA PAARPAAVVA AAGPDTQARR PRATPAAQ         538
//

If you have problems or comments...

PBIL Back to PBIL home page