(data stored in SCRATCH9089 zone)

EMBL: CP000124.PAAG

CP000124.PAAG        Location/Qualifiers
FT   CDS             8346..9344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="BURPS1710b_0007"
FT                   /product="phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /note="identified by match to protein family HMM PF05138;
FT                   match to protein family HMM TIGR02156"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49021"
FT                   /db_xref="GOA:Q3JYC8"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC8"
FT                   /protein_id="ABA49021.1"
FT                   /translation="MYTQSLDIPGNIAPIDAAADSPEQAGFDAAIAADGKIEPQDWMPD
FT                   AYRKTLVRQISQHAHSEVVGMLPEGNWITRAPSLKRKAILLAKVQDEAGHGLYLYSAAE
FT                   TLGVSRDALIDALHAGKAKYSSIFNYPTLTWADVGVIGWLVDGAAIMNQVPLCRCTYGP
FT                   YARAMIRVCKEESFHQRQGFDALLAMMKGTDAQRAMVQEAVDRWWWPVLMMFGPPDADS
FT                   VHSNQSAKWGIKRISNDDLRQKFVDATVEQAKVLGVTLPDPDLKWNDARGHFDYGALDW
FT                   DEFWRVVNGDGPCNKERLATRVKAHENGAWVRDAALAHEEKRRRRAQQQAA"
     MYTQSLDIPG NIAPIDAAAD SPEQAGFDAA IAADGKIEPQ DWMPDAYRKT LVRQISQHAH        60
     SEVVGMLPEG NWITRAPSLK RKAILLAKVQ DEAGHGLYLY SAAETLGVSR DALIDALHAG       120
     KAKYSSIFNY PTLTWADVGV IGWLVDGAAI MNQVPLCRCT YGPYARAMIR VCKEESFHQR       180
     QGFDALLAMM KGTDAQRAMV QEAVDRWWWP VLMMFGPPDA DSVHSNQSAK WGIKRISNDD       240
     LRQKFVDATV EQAKVLGVTL PDPDLKWNDA RGHFDYGALD WDEFWRVVNG DGPCNKERLA       300
     TRVKAHENGA WVRDAALAHE EKRRRRAQQQ AA                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page