(data stored in SCRATCH9089 zone)

EMBL: CP000124.PCAD

CP000124.PCAD        Location/Qualifiers
FT   CDS             111607..112725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="BURPS1710b_0111"
FT                   /product="3-oxoadipate enol-lactone hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50971"
FT                   /db_xref="GOA:Q3JY25"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY25"
FT                   /protein_id="ABA50971.1"
FT                   /translation="MHRCVSIPYISRCRLYRRVRRACGTPGFACCTCRIRHVPRWQARL
FT                   ISRYVGDNVARRFHRSARESGNHDDCRRLLRHAHRFRAFARTPLTDSLPSDLIDMPFVT
FT                   IDGQPLHYQIRGAGAPVLFGHSYLWDSSMWEPQLDALSKSYRVIAPDLWGHGRSGPLPD
FT                   GTRSLDDLARQMSELLDHLDIDTCSIVGLSVGGMWAVPLAHRAPQRIDRLVLMDTYVGV
FT                   EPDATRNQYFQMLEAIDAQGAIPAPLLDAIVPIFFRPGIDPASELPTGFRRALQAFTTE
FT                   RLRDSVIPLGKITFGREDARAQLSALPADRTLVMCGANDVARPPEEADEIAALIGCEKA
FT                   FVPNAGHISNLENPAFVTQALSDWLGRGAARA"
     MHRCVSIPYI SRCRLYRRVR RACGTPGFAC CTCRIRHVPR WQARLISRYV GDNVARRFHR        60
     SARESGNHDD CRRLLRHAHR FRAFARTPLT DSLPSDLIDM PFVTIDGQPL HYQIRGAGAP       120
     VLFGHSYLWD SSMWEPQLDA LSKSYRVIAP DLWGHGRSGP LPDGTRSLDD LARQMSELLD       180
     HLDIDTCSIV GLSVGGMWAV PLAHRAPQRI DRLVLMDTYV GVEPDATRNQ YFQMLEAIDA       240
     QGAIPAPLLD AIVPIFFRPG IDPASELPTG FRRALQAFTT ERLRDSVIPL GKITFGREDA       300
     RAQLSALPAD RTLVMCGAND VARPPEEADE IAALIGCEKA FVPNAGHISN LENPAFVTQA       360
     LSDWLGRGAA RA                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page