(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE102

CP000124.PE102       Location/Qualifiers
FT   CDS             complement(109702..110130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0108"
FT                   /product="unnamed protein product"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49861"
FT                   /db_xref="GOA:Q3JY28"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY28"
FT                   /protein_id="ABA49861.1"
FT                   /translation="MKKTFKTGAWLPVAAAGVLLAGCAANQPKPLYQWDGYQPQVYEYF
FT                   KGQKSPEDQIDALEKALQQIRAKGNRPPPGFEAHLGMLYASVGKEQQAEQSFQAEKASF
FT                   PESSPFMDFLLKKKAAAPQAKPSAPAQPQTQTQTQAQQ"
     MKKTFKTGAW LPVAAAGVLL AGCAANQPKP LYQWDGYQPQ VYEYFKGQKS PEDQIDALEK        60
     ALQQIRAKGN RPPPGFEAHL GMLYASVGKE QQAEQSFQAE KASFPESSPF MDFLLKKKAA       120
     APQAKPSAPA QPQTQTQTQA QQ                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page