(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE106

CP000124.PE106       Location/Qualifiers
FT   CDS             complement(112778..114595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0112"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50171"
FT                   /db_xref="GOA:Q3JY24"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY24"
FT                   /protein_id="ABA50171.1"
FT                   /translation="MSPFMLSSIRSRILVACLAIVIGSLVINTALNYFVANRYNRESIS
FT                   QNLSAVLTGHEAGIADWVASKTQMIVSVEDAAISPDPIPALKQIAAAGGFTNVYVGYAD
FT                   KTAKFSDPTGIPPDYDPTGRPWYKQAAQAGKPVVTPPYVDVGTGKLVVAFAAPIMRDGA
FT                   LKGVVSGDVAMDSVIANVKAIHPTPGSFGMLVDRSGHIVAHADSKLTLKPVTDLSDDLS
FT                   LDALAAASADENAAPIDAHVAGAAKLMRARAVPGTDWLTVVALDKSDATAGMHSLLLVS
FT                   IGTLVALAAVAALIVGAITGVAFRGLARIRDAMESIGSGTGDLTQRLPDSGRDEVAQIA
FT                   RSFNAFVSKLQEVMRVIRDASESVRHAAGEIASGNHDLSRRTESAAASLQQTAASIEEI
FT                   TSTVTQSAGAARQANDIATNAASVASRGGTVVSDVVSTMHEIEGASGKIADIIGVIDGI
FT                   AFQTNILALNAAVEAARAGEEGRGFAVVAGEVRSLAQRSAQAAKEIKALIDSSVTSVST
FT                   GATLVQQAGQTMSDIVGTVSNVTTIMREISNAADEQTRGIQEVNRAVAQLDEMVQQNAA
FT                   LVEQSAAAASALQTQAVELADAVGQFKVA"
     MSPFMLSSIR SRILVACLAI VIGSLVINTA LNYFVANRYN RESISQNLSA VLTGHEAGIA        60
     DWVASKTQMI VSVEDAAISP DPIPALKQIA AAGGFTNVYV GYADKTAKFS DPTGIPPDYD       120
     PTGRPWYKQA AQAGKPVVTP PYVDVGTGKL VVAFAAPIMR DGALKGVVSG DVAMDSVIAN       180
     VKAIHPTPGS FGMLVDRSGH IVAHADSKLT LKPVTDLSDD LSLDALAAAS ADENAAPIDA       240
     HVAGAAKLMR ARAVPGTDWL TVVALDKSDA TAGMHSLLLV SIGTLVALAA VAALIVGAIT       300
     GVAFRGLARI RDAMESIGSG TGDLTQRLPD SGRDEVAQIA RSFNAFVSKL QEVMRVIRDA       360
     SESVRHAAGE IASGNHDLSR RTESAAASLQ QTAASIEEIT STVTQSAGAA RQANDIATNA       420
     ASVASRGGTV VSDVVSTMHE IEGASGKIAD IIGVIDGIAF QTNILALNAA VEAARAGEEG       480
     RGFAVVAGEV RSLAQRSAQA AKEIKALIDS SVTSVSTGAT LVQQAGQTMS DIVGTVSNVT       540
     TIMREISNAA DEQTRGIQEV NRAVAQLDEM VQQNAALVEQ SAAAASALQT QAVELADAVG       600
     QFKVA                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page