(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE108

CP000124.PE108       Location/Qualifiers
FT   CDS             complement(116708..117352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0114"
FT                   /product="Chitin binding domain"
FT                   /note="identified by match to protein family HMM PF03067"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49030"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="PDB:3UAM"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY22"
FT                   /protein_id="ABA49030.1"
FT                   /translation="MSTTDSRSATKSSSISPRHGRVITPESRAVYLYEAGRLDFGQVNE
FT                   LEGGKFFPATQSGLRDPDAPDDVANGMPPRDGEIASGGRTADARAQLNEPDSVAHWQKH
FT                   AVRSGQSLQISWSYSMPHKTRRWTYWITKPGWDTQARLARAHFEPDPLKVYLNTYQPYW
FT                   GPDADKELIPQGETIHEFNLPTRTGYHVLLAVWDVADTANAFYQVIDLNFA"
     MSTTDSRSAT KSSSISPRHG RVITPESRAV YLYEAGRLDF GQVNELEGGK FFPATQSGLR        60
     DPDAPDDVAN GMPPRDGEIA SGGRTADARA QLNEPDSVAH WQKHAVRSGQ SLQISWSYSM       120
     PHKTRRWTYW ITKPGWDTQA RLARAHFEPD PLKVYLNTYQ PYWGPDADKE LIPQGETIHE       180
     FNLPTRTGYH VLLAVWDVAD TANAFYQVID LNFA                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page