(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE109

CP000124.PE109       Location/Qualifiers
FT   CDS             complement(118253..118501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47454"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY21"
FT                   /protein_id="ABA47454.1"
FT                   /translation="MTVSKRAMHTDWVDPDDAPELTDEFFERADEYVGDRLVRRGPGRP
FT                   LGSHKTATTIRLDDDVLDAFKATGRGWQTRVNAALKE"
     MTVSKRAMHT DWVDPDDAPE LTDEFFERAD EYVGDRLVRR GPGRPLGSHK TATTIRLDDD        60
     VLDAFKATGR GWQTRVNAAL KE                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page