(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE111

CP000124.PE111       Location/Qualifiers
FT   CDS             complement(122160..122477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0117"
FT                   /product="putative DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49498"
FT                   /db_xref="GOA:Q3JY19"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY19"
FT                   /protein_id="ABA49498.1"
FT                   /translation="MKRASAEGFNLIQHTVDDTEHLLAKPGVRAAYDALEDEYMALRAI
FT                   LAIRHEAGLTQAQVAERMGTTASAVSRLEASLSSEKHSPSFATLRKYAAAFGKRLVISF
FT                   A"
     MKRASAEGFN LIQHTVDDTE HLLAKPGVRA AYDALEDEYM ALRAILAIRH EAGLTQAQVA        60
     ERMGTTASAV SRLEASLSSE KHSPSFATLR KYAAAFGKRL VISFA                       105
//

If you have problems or comments...

PBIL Back to PBIL home page