(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE112

CP000124.PE112       Location/Qualifiers
FT   CDS             complement(122485..122805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0118"
FT                   /product="putative bacteriophage protein"
FT                   /note="identified by match to protein family HMM PF05973"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50322"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY18"
FT                   /protein_id="ABA50322.1"
FT                   /translation="MDSRLLQRARQTRRLRAAGRDSGRLSAAPGLDAGVRRGFAYAALA
FT                   SNGGGLFELRPKGREGIGRVFYCTHVGQRVVVLHSFVKKTQETPQNELRTARVRLSEVR
FT                   NG"
     MDSRLLQRAR QTRRLRAAGR DSGRLSAAPG LDAGVRRGFA YAALASNGGG LFELRPKGRE        60
     GIGRVFYCTH VGQRVVVLHS FVKKTQETPQ NELRTARVRL SEVRNG                      106
//

If you have problems or comments...

PBIL Back to PBIL home page