(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE117

CP000124.PE117       Location/Qualifiers
FT   CDS             129021..129824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0124"
FT                   /product="GDSL-like Lipase/Acylhydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48190"
FT                   /db_xref="GOA:Q3JY13"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY13"
FT                   /protein_id="ABA48190.1"
FT                   /translation="MTRARRYHERTLSISTPVTMERHMGYHFATAALGPLLLAQGRHVR
FT                   RVTPRLAEADGPRGGADGAGPPLRLLVLGDSAAAGVGVASQSDALAGQLVRALAPFHRV
FT                   EWRLLARTGATTQDLLDWLDAEPDARFDAVVTSLGVNDVTDGVPPARWLDAQAALVERL
FT                   TARFGAAHVVLTAVPPMHRFPALPQPLRWYLGLRAARLNAALSRWAAGRPACEFLRVDM
FT                   PLTRDAMASDGFHPGTQACAAWAGQAAAAIRRRVAAATRLQAAVG"
     MTRARRYHER TLSISTPVTM ERHMGYHFAT AALGPLLLAQ GRHVRRVTPR LAEADGPRGG        60
     ADGAGPPLRL LVLGDSAAAG VGVASQSDAL AGQLVRALAP FHRVEWRLLA RTGATTQDLL       120
     DWLDAEPDAR FDAVVTSLGV NDVTDGVPPA RWLDAQAALV ERLTARFGAA HVVLTAVPPM       180
     HRFPALPQPL RWYLGLRAAR LNAALSRWAA GRPACEFLRV DMPLTRDAMA SDGFHPGTQA       240
     CAAWAGQAAA AIRRRVAAAT RLQAAVG                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page