(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE127

CP000124.PE127       Location/Qualifiers
FT   CDS             143743..144810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48530"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY03"
FT                   /protein_id="ABA48530.1"
FT                   /translation="MTPTLDETALPPADALAYPGTLLSPDGRLVAPYDLERPGADARGH
FT                   VGAAARAGLLHAASGPFTLDYATLSTVHVINGMGVALGDSVIGLTALAAIKARHPHVHF
FT                   VLYRPAHAPAYVDALYRLAADAIAPIRALPWPAAELPARDTRIDLGNHLYWPAFAARPM
FT                   IDFFLASLGVPPESIPADAKCNRWLARLTLPPLPPEWRDRPYALFCPQASTPLRSIPAA
FT                   QRAALVERLARTYRLPVLGFGPIDHPDYVDVSGHSADTAQFVSWVGRARVALCSDTSAV
FT                   HIAAGFDVPTLACFSSIAPELRVRDYPLCTAIELDMPEMLRNRHKSDAANDIAQVDAAY
FT                   RRIDWDAIAWPPARE"
     MTPTLDETAL PPADALAYPG TLLSPDGRLV APYDLERPGA DARGHVGAAA RAGLLHAASG        60
     PFTLDYATLS TVHVINGMGV ALGDSVIGLT ALAAIKARHP HVHFVLYRPA HAPAYVDALY       120
     RLAADAIAPI RALPWPAAEL PARDTRIDLG NHLYWPAFAA RPMIDFFLAS LGVPPESIPA       180
     DAKCNRWLAR LTLPPLPPEW RDRPYALFCP QASTPLRSIP AAQRAALVER LARTYRLPVL       240
     GFGPIDHPDY VDVSGHSADT AQFVSWVGRA RVALCSDTSA VHIAAGFDVP TLACFSSIAP       300
     ELRVRDYPLC TAIELDMPEM LRNRHKSDAA NDIAQVDAAY RRIDWDAIAW PPARE            355
//

If you have problems or comments...

PBIL Back to PBIL home page