(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE135

CP000124.PE135       Location/Qualifiers
FT   CDS             complement(150556..152118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ5"
FT                   /protein_id="ABA49155.1"
FT                   /translation="MPIFDNTSINDSLASILSGEPRLSRCRIPPLRGEIHADRVEWPPR
FT                   RGRRRSAAGASADARHVAAVGNCRRPRDFGRVLRLELRLGERGHARLRRHRAVRRGDVH
FT                   DLHLQLHRAHDVDSARGRPVRLCAARVRPGGRLSGGRRDPCRVRVRAARDRARDRRVPA
FT                   RAVSRPRAEARGDGRVPRVHGAEYRRRADRRDVRARRHAARDLRAARVHGRRVAGLRLE
FT                   QLREGRLGGRRSLQRRRVPWHVRGDPVRDLVLPRDRGRRDGGRGGEAPETLDSDRVRGR
FT                   HPDARGARDRRDGVRGRRGRLDQAREYQRSAAAGDEVHRRREQRLDAHARVARPVRPRR
FT                   VVPRDHSRLFAPDLRARPRRLPARMAREGAPALQDALSRDPRGRRGRHRRDLQRRADPV
FT                   RRPDAHREHRDDVRVRRYRDVHRQHGRALQAAPRAAEDGAPVPRAAVSVLPGVRARRGA
FT                   RVPRHDGVLQRARRVDLRRVRRARVRLLPRDARAARGRARRRAARGVAGVRRAPEGGAR
FT                   PLR"
     MPIFDNTSIN DSLASILSGE PRLSRCRIPP LRGEIHADRV EWPPRRGRRR SAAGASADAR        60
     HVAAVGNCRR PRDFGRVLRL ELRLGERGHA RLRRHRAVRR GDVHDLHLQL HRAHDVDSAR       120
     GRPVRLCAAR VRPGGRLSGG RRDPCRVRVR AARDRARDRR VPARAVSRPR AEARGDGRVP       180
     RVHGAEYRRR ADRRDVRARR HAARDLRAAR VHGRRVAGLR LEQLREGRLG GRRSLQRRRV       240
     PWHVRGDPVR DLVLPRDRGR RDGGRGGEAP ETLDSDRVRG RHPDARGARD RRDGVRGRRG       300
     RLDQAREYQR SAAAGDEVHR RREQRLDAHA RVARPVRPRR VVPRDHSRLF APDLRARPRR       360
     LPARMAREGA PALQDALSRD PRGRRGRHRR DLQRRADPVR RPDAHREHRD DVRVRRYRDV       420
     HRQHGRALQA APRAAEDGAP VPRAAVSVLP GVRARRGARV PRHDGVLQRA RRVDLRRVRR       480
     ARVRLLPRDA RAARGRARRR AARGVAGVRR APEGGARPLR                             520
//

If you have problems or comments...

PBIL Back to PBIL home page