(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE137

CP000124.PE137       Location/Qualifiers
FT   CDS             152501..153808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0144"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49479"
FT                   /db_xref="GOA:Q3JXZ3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ3"
FT                   /protein_id="ABA49479.1"
FT                   /translation="MSSGTQIAVARTPTLSMCSRRTAHRFRAAPGCPTKNHSNDRETMR
FT                   DSYLDTARGAGIILVVYGHVLRGLFSAGLVPAGWPSALLAATDYTIYTFHMPLFFLLSG
FT                   LHVPKSLRRAGDVFLLTKLRTIVYPYFVWSLLQGAVQIALSARGTNHAFTPNDLLAIGW
FT                   RPFGQFWFLYALFICMLIAWAVSAITLRARTHGGASGANGENGGTEVSGENGEPSGAPC
FT                   AVPAMPIVLVLLAIGGLAAVAFVAGSATRWGIVSMTLAYFPFFVLGMLIGERLPAFLER
FT                   VSSGPALVAVAATFAASVAFAHRFGESDSIWALPAALSGSALVLLVAHRAARRGDAARH
FT                   APRASWLEYLGFASMPIYLAHILATAATRIALVTLGIVDVGAQLALGTFAGVLGPTLLY
FT                   ALALRAGTARLAGFPPLPAGYAMTPDKGRIGRADAA"
     MSSGTQIAVA RTPTLSMCSR RTAHRFRAAP GCPTKNHSND RETMRDSYLD TARGAGIILV        60
     VYGHVLRGLF SAGLVPAGWP SALLAATDYT IYTFHMPLFF LLSGLHVPKS LRRAGDVFLL       120
     TKLRTIVYPY FVWSLLQGAV QIALSARGTN HAFTPNDLLA IGWRPFGQFW FLYALFICML       180
     IAWAVSAITL RARTHGGASG ANGENGGTEV SGENGEPSGA PCAVPAMPIV LVLLAIGGLA       240
     AVAFVAGSAT RWGIVSMTLA YFPFFVLGML IGERLPAFLE RVSSGPALVA VAATFAASVA       300
     FAHRFGESDS IWALPAALSG SALVLLVAHR AARRGDAARH APRASWLEYL GFASMPIYLA       360
     HILATAATRI ALVTLGIVDV GAQLALGTFA GVLGPTLLYA LALRAGTARL AGFPPLPAGY       420
     AMTPDKGRIG RADAA                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page