(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE139

CP000124.PE139       Location/Qualifiers
FT   CDS             complement(154181..155644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0146"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF05552"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48977"
FT                   /db_xref="GOA:Q3JXZ1"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ1"
FT                   /protein_id="ABA48977.1"
FT                   /translation="MDSSSFLTSMQSTLGVYLPKIAGALGILVIGWLIAVIVRAGVRRL
FT                   LSALKVDARIAESTGQGTQVERIIAGGLFWLVLLVTAVGIFNVLNLYAISNPFSLLVTK
FT                   IINYLPNLLGGAALTLVAWLIASLLRSLADKTLKASRIDSKLSETAGMRPMSSYLGDVL
FT                   FWLVILMFIPAILAAFDLNGLLSPVQGMIDKILAIVPNVFAAAVIGFVGWLVARILRGL
FT                   VTNLLVAAGADRLTQSVESPTPVKLSNLVGTVVFIFVFVPTLISALDALKIEAISRPAT
FT                   DLLGQFLNAVPDIVAAVVIVLVTFYVARFVGALVQKLLVAAGVDGLPAMLGVERVFTGM
FT                   LQPSVLAGRLIVFFAMLFATVEAANRLGFTQVRDVVTLFIEFGGHVLMGGVILVIGFWL
FT                   AGLARRVIEQADNEHSRLLSRIAQFAILGLVFAMGLRAMGIANEIVQLAFGLVLGAIAV
FT                   AVALSFGLGGREAAGKLLDRWFNQRGKQE"
     MDSSSFLTSM QSTLGVYLPK IAGALGILVI GWLIAVIVRA GVRRLLSALK VDARIAESTG        60
     QGTQVERIIA GGLFWLVLLV TAVGIFNVLN LYAISNPFSL LVTKIINYLP NLLGGAALTL       120
     VAWLIASLLR SLADKTLKAS RIDSKLSETA GMRPMSSYLG DVLFWLVILM FIPAILAAFD       180
     LNGLLSPVQG MIDKILAIVP NVFAAAVIGF VGWLVARILR GLVTNLLVAA GADRLTQSVE       240
     SPTPVKLSNL VGTVVFIFVF VPTLISALDA LKIEAISRPA TDLLGQFLNA VPDIVAAVVI       300
     VLVTFYVARF VGALVQKLLV AAGVDGLPAM LGVERVFTGM LQPSVLAGRL IVFFAMLFAT       360
     VEAANRLGFT QVRDVVTLFI EFGGHVLMGG VILVIGFWLA GLARRVIEQA DNEHSRLLSR       420
     IAQFAILGLV FAMGLRAMGI ANEIVQLAFG LVLGAIAVAV ALSFGLGGRE AAGKLLDRWF       480
     NQRGKQE                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page