(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE142

CP000124.PE142       Location/Qualifiers
FT   CDS             complement(156560..156973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0148"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47557"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY8"
FT                   /protein_id="ABA47557.1"
FT                   /translation="MDWFKWLAGGRHRGYGGGRGHHGGEAGGGHGHGGGHGERGDHGSH
FT                   GYGGHGWGRQGVQRGGGWNDARDGAPLRGEAGAPAQHAACAKCGAINGAEAKFCAQCGA
FT                   SQTPPVCGACRAPLAASARFCPQCGTAVSAQRG"
     MDWFKWLAGG RHRGYGGGRG HHGGEAGGGH GHGGGHGERG DHGSHGYGGH GWGRQGVQRG        60
     GGWNDARDGA PLRGEAGAPA QHAACAKCGA INGAEAKFCA QCGASQTPPV CGACRAPLAA       120
     SARFCPQCGT AVSAQRG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page