(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE157

CP000124.PE157       Location/Qualifiers
FT   CDS             168230..169852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48763"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX3"
FT                   /protein_id="ABA48763.1"
FT                   /translation="MGRDGDRACRAARGGRRRSRGPGRKRGRRRRRRAARVLRDAPRRV
FT                   QDSARIRVRRAPAAHADGQTTEVSAARARRRVTPRRRRIGLPRPPRAKRRMPHRRTAQR
FT                   KAGKPGIRQRIAQPRKNKTPVPPPRTRGSPMPASTSKRAANAAIRRARHALRRLLAADA
FT                   LQGLPFALLDLVHRDAAVPQVALRVIRDVRRRHARHVGLREQRQILRRVRRVRLLHRAE
FT                   HRHRAVVRIRRVRLHVFAEALLVLVRVRLAAGHFGERQAGERSDRAFGRVARDLQEGRR
FT                   VHHLAAHQRRRDAERLHLLGHRRGLRIRAAVVDEVRLRRLELRQDRLEVDSLVVREFTI
FT                   DDRRARRLRRLLELVGKALAVSGAIVDDRDLLHAEILHRERARDRALLRVGRHHPEGRL
FT                   VALRRVLGRRRHRDLRDARVRVDARSRNRRARVEVAEHALDAVVDELLRDRRAGARVGL
FT                   IVLRVEHELHRLAADRRLRRVDVLDREHDPVLHILAVVRLRARHRRGKADLDVIRVRRP
FT                   RERHDRDERRACQLFHRVLHIFS"
     MGRDGDRACR AARGGRRRSR GPGRKRGRRR RRRAARVLRD APRRVQDSAR IRVRRAPAAH        60
     ADGQTTEVSA ARARRRVTPR RRRIGLPRPP RAKRRMPHRR TAQRKAGKPG IRQRIAQPRK       120
     NKTPVPPPRT RGSPMPASTS KRAANAAIRR ARHALRRLLA ADALQGLPFA LLDLVHRDAA       180
     VPQVALRVIR DVRRRHARHV GLREQRQILR RVRRVRLLHR AEHRHRAVVR IRRVRLHVFA       240
     EALLVLVRVR LAAGHFGERQ AGERSDRAFG RVARDLQEGR RVHHLAAHQR RRDAERLHLL       300
     GHRRGLRIRA AVVDEVRLRR LELRQDRLEV DSLVVREFTI DDRRARRLRR LLELVGKALA       360
     VSGAIVDDRD LLHAEILHRE RARDRALLRV GRHHPEGRLV ALRRVLGRRR HRDLRDARVR       420
     VDARSRNRRA RVEVAEHALD AVVDELLRDR RAGARVGLIV LRVEHELHRL AADRRLRRVD       480
     VLDREHDPVL HILAVVRLRA RHRRGKADLD VIRVRRPRER HDRDERRACQ LFHRVLHIFS       540
//

If you have problems or comments...

PBIL Back to PBIL home page