(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE160

CP000124.PE160       Location/Qualifiers
FT   CDS             170396..174043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48176"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX0"
FT                   /protein_id="ABA48176.1"
FT                   /translation="MRQIAVAARGERRLALLDQPVAQRGERSGWIIARLAFLRRIGDER
FT                   RLERARQPGRARREQALQVERAARLRPRARQPFAAERLHAHHRADHVAVHVDVADVRAR
FT                   DHVRDRLVDPRVNAEREPIARRADLLEQLVEAAAAITHDVQHRAEHFTLELVDVADLDD
FT                   RRRHERALRACVRHLELRDRVPLVLHRRDVRVDRALRVGVDHRADVHRQPVRIAERELA
FT                   HRALEHRQRAIRDVVLQTQNAQRRTALTGRVERRLQHVGDHLLGERRRIDDHRVLAARL
FT                   GDQRDRPAVRIEARRQRLVDEARDFGRAGEHHRARAGVRHERRAHRLAVARQQLHRARR
FT                   HAGVAQQAHRLRGDQRRLLGRLREHRVARRQGGCDLAHENREREVPRADADDGAERAVR
FT                   VVREFVADLRRVVAQEVDRFADLGDRVRQRFARLAHDQAHQRVHLRFEQVRRAREAVRA
FT                   RVDGRRLPDRRGRDRVRERRAHLVGRRFAHRADDVAQIGRIAHVARRGVGERVVGEHRR
FT                   GAPRMMRAREQRRRQRREPVLVRQIEAHRIDARRTVQLARQRNLRVRRAERHDLQRILD
FT                   RIGHQFLHRHGLVGDPVHERRVRAVFQQAAHEIRKQRLVRADGRVHAAWAVQLVAAGDF
FT                   LVQRLAHPVQALELVLAGVVVLAREVIDRGERVRVVRRELRIHGVRRGEQLLRAREVGH
FT                   VGVDLARIDRIAFEAVHLRALDLGIPVRALHEADHQAMAAAAREVDKVVDHERAALLVR
FT                   LHDEADAVPAGELRIEAQRLEQIERELEPVRLLGVDVQADVIAAREQRERAHARQQLVH
FT                   RAFLLGARVARMQRRELDRDARALVDAAAARRLADRVDRLLVRRVVAQRVLFGGRRFAE
FT                   HVVRVAEAARLVLAAVRERFGDRLARDELLAHQAHRHVDALSDQRLAALADQPRERRRQ
FT                   ARLAVRRDELAGDHQAPGGRVDEQRRRVADVRAPVALADLVANQRVARRAIGNPQQRLG
FT                   EAHQRDALLARQREFMDQPLDAAARALLAQRLDKARRHCLHVRREARGQPRLADQERHA
FT                   FGLRPPVRGRDRRAQHRLRLHALREFEERVRRAVVVAVGVAVGQIGDARVAGELRRKLT
FT                   MLDPLEIREDRLLDQPVRSALEPRRRVLQTRAQQIVDFDAQCGACHDFLLVPARCRPRT
FT                   LKDRKIVRQAIKRCNQISHPVAPHISPLLSITYQKRQPARTTLNDRYFP"
     MRQIAVAARG ERRLALLDQP VAQRGERSGW IIARLAFLRR IGDERRLERA RQPGRARREQ        60
     ALQVERAARL RPRARQPFAA ERLHAHHRAD HVAVHVDVAD VRARDHVRDR LVDPRVNAER       120
     EPIARRADLL EQLVEAAAAI THDVQHRAEH FTLELVDVAD LDDRRRHERA LRACVRHLEL       180
     RDRVPLVLHR RDVRVDRALR VGVDHRADVH RQPVRIAERE LAHRALEHRQ RAIRDVVLQT       240
     QNAQRRTALT GRVERRLQHV GDHLLGERRR IDDHRVLAAR LGDQRDRPAV RIEARRQRLV       300
     DEARDFGRAG EHHRARAGVR HERRAHRLAV ARQQLHRARR HAGVAQQAHR LRGDQRRLLG       360
     RLREHRVARR QGGCDLAHEN REREVPRADA DDGAERAVRV VREFVADLRR VVAQEVDRFA       420
     DLGDRVRQRF ARLAHDQAHQ RVHLRFEQVR RAREAVRARV DGRRLPDRRG RDRVRERRAH       480
     LVGRRFAHRA DDVAQIGRIA HVARRGVGER VVGEHRRGAP RMMRAREQRR RQRREPVLVR       540
     QIEAHRIDAR RTVQLARQRN LRVRRAERHD LQRILDRIGH QFLHRHGLVG DPVHERRVRA       600
     VFQQAAHEIR KQRLVRADGR VHAAWAVQLV AAGDFLVQRL AHPVQALELV LAGVVVLARE       660
     VIDRGERVRV VRRELRIHGV RRGEQLLRAR EVGHVGVDLA RIDRIAFEAV HLRALDLGIP       720
     VRALHEADHQ AMAAAAREVD KVVDHERAAL LVRLHDEADA VPAGELRIEA QRLEQIEREL       780
     EPVRLLGVDV QADVIAAREQ RERAHARQQL VHRAFLLGAR VARMQRRELD RDARALVDAA       840
     AARRLADRVD RLLVRRVVAQ RVLFGGRRFA EHVVRVAEAA RLVLAAVRER FGDRLARDEL       900
     LAHQAHRHVD ALSDQRLAAL ADQPRERRRQ ARLAVRRDEL AGDHQAPGGR VDEQRRRVAD       960
     VRAPVALADL VANQRVARRA IGNPQQRLGE AHQRDALLAR QREFMDQPLD AAARALLAQR      1020
     LDKARRHCLH VRREARGQPR LADQERHAFG LRPPVRGRDR RAQHRLRLHA LREFEERVRR      1080
     AVVVAVGVAV GQIGDARVAG ELRRKLTMLD PLEIREDRLL DQPVRSALEP RRRVLQTRAQ      1140
     QIVDFDAQCG ACHDFLLVPA RCRPRTLKDR KIVRQAIKRC NQISHPVAPH ISPLLSITYQ      1200
     KRQPARTTLN DRYFP                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page