(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE189

CP000124.PE189       Location/Qualifiers
FT   CDS             complement(202886..203860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0196"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter integral membrane subunit"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51184"
FT                   /db_xref="GOA:Q3JXU1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU1"
FT                   /protein_id="ABA51184.1"
FT                   /translation="MQRKALYGLLLLGLLVAPFVGAYPVFVMKVLCFALFAAAFNLLIG
FT                   FTGLLSFGHAMFLATAGYVTGYAMQSLGTAPELGVLAGTAAATLLGLVVGLFAIRRQGI
FT                   YFAMITLAFAQMVYFIYLQAPFTHGEDGLQGVPRGRLFGLVDLSSDLALYYVVLVVIAC
FT                   ACFFIVRIVHSPFGQVLVAIKENEPRAISLGYDTDRFKLLAFILSAALAGLAGALKVVV
FT                   LGFETLSDAYWTMSGLVVLMTLVGGMGTLFGPLVGAALIVALEDRLGDIGGWLASVTHI
FT                   DWFRSLGESATIVTGLIFIVCVLAFRRGIVGEVIARVRPLRAS"
     MQRKALYGLL LLGLLVAPFV GAYPVFVMKV LCFALFAAAF NLLIGFTGLL SFGHAMFLAT        60
     AGYVTGYAMQ SLGTAPELGV LAGTAAATLL GLVVGLFAIR RQGIYFAMIT LAFAQMVYFI       120
     YLQAPFTHGE DGLQGVPRGR LFGLVDLSSD LALYYVVLVV IACACFFIVR IVHSPFGQVL       180
     VAIKENEPRA ISLGYDTDRF KLLAFILSAA LAGLAGALKV VVLGFETLSD AYWTMSGLVV       240
     LMTLVGGMGT LFGPLVGAAL IVALEDRLGD IGGWLASVTH IDWFRSLGES ATIVTGLIFI       300
     VCVLAFRRGI VGEVIARVRP LRAS                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page